SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0155813 from Drosophila grimshawi 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0155813
Domain Number 1 Region: 200-305
Classification Level Classification E-value
Superfamily SH2 domain 2.83e-23
Family SH2 domain 0.001
Further Details:      
 
Domain Number 2 Region: 328-374
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000275
Family SOCS box-like 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0155813   Gene: FBgn0129368   Transcript: FBtr0157321
Sequence length 383
Comment type=protein; loc=scaffold_15245:join(14928778..14928940,14929067..14929583,14929663..14930134); ID=FBpp0155813; name=DgriGH21907-PA; parent=FBgn0129368,FBtr0157321; dbxref=GB_protein:EDW02276,FlyBase:FBpp0155813,FlyBase_Annotation_IDs:GH21907-PA,REFSEQ:XP_001987409,FlyMine:FBpp0155813; MD5=fa3198f6cafa951962eaa80e75b2b824; length=383; release=r1.3; species=Dgri;
Sequence
MSNGENNTNSRTQNQGQGAVDANTSGSAAAGIANRARSQNPSSQGLLALGNMEQTAGAVA
TKAATKEKRSWFHSLTRRKKSDSASSSLTVAASSHAVQLHTNNNNEPMEASCSTAASVGN
NCSSSSNNSTIGGVMRKRKEKKNVFTRLGKKMGLGLSALRNWHSMGDDCDCDGGTTDAMY
EFLSPPIASEPTLPFTHDYMRFISKKWLERQESPNVVMYTTCSEMLNQVWYWGEISRRDS
QRQLSDKPTGSFLVRDSETSGSQFTLSFRIMNVTLHYRLEYRDQFWHFEELKYGSIVQMI
DDILHRCTNDNFVCFVKVPNEMQPPFPVILKYPLSRYLNMPKLQDLCRRVLQRQMPVAEL
AKLPVPAQMLEYLSVERELVFQS
Download sequence
Identical sequences B4J8B7
7222.FBpp0155813 XP_001987409.1.65300 FBpp0155813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]