SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0157990 from Drosophila grimshawi 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0157990
Domain Number 1 Region: 241-310
Classification Level Classification E-value
Superfamily Homeodomain-like 4.28e-21
Family Homeodomain 0.0021
Further Details:      
 
Domain Number 2 Region: 53-117
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000091
Family LIM domain 0.02
Further Details:      
 
Domain Number 3 Region: 26-51
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000017
Family LIM domain 0.025
Further Details:      
 
Weak hits

Sequence:  FBpp0157990
Domain Number - Region: 114-151
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0135
Family LIM domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0157990   Gene: FBgn0131540   Transcript: FBtr0159498
Sequence length 501
Comment type=protein; loc=scaffold_14853:complement(8617137..8617504,8618253..8618514,8631623..8631841,8632139..8632329,8655950..8656176,8657719..8657914,8677356..8677398); ID=FBpp0157990; name=DgriGH24084-PA; parent=FBgn0131540,FBtr0159498; dbxref=GB_protein:EDV92380,FlyBase:FBpp0157990,FlyBase_Annotation_IDs:GH24084-PA,REFSEQ:XP_001992673,FlyMine:FBpp0157990; MD5=3cc6b7f1f52e5bcd6e23c4a06fca4169; length=501; release=r1.3; species=Dgri;
Sequence
MAFGAVLHTNQHNIGRSEPPVGVGDPCAGCNKPILDKFLLNVLERAWHASCVRCCECLQP
LTDKCFSRESKLYCRNDFFRRYGTKCSGCGQGIAPSDLVRKPRDKVFHLNCFTCCICRKQ
LSTGEQLYVLDDNKFICKDDYLLGKAPSCGHNSLSDSLMGSASEDEDDDDPPHLRGPALG
LGVLGPNGPDSAGGPLGTSDISVQSMSTDSKNTHDDSDQGSLDGDPDGRGDSQAENKSPD
DANGSKRRGPRTTIKAKQLEVLKTAFNQTPKPTRHIREQLAKETGLPMRVIQVWFQNKRS
KERRMKQITSMGRPPFFGGARKMRGFPMNLSPGGLDDGPGFPYFAADAKFEFGYGGPFHP
HDGPFFPGHPGGPMPFNAPGGPMDHSGPIPMVNEFGLTPESTFLSQAGAPPMQLQTSVGP
PPPPPPPNAADHLLQQAATQQQQQQQQQQQAAQNAQQASQAQQQQQQQQQQQNGPRTASP
EFMSSANFSEPQNMQNEGLVW
Download sequence
Identical sequences B4JNT7
XP_001992673.1.65300 7222.FBpp0157990 FBpp0157990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]