SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0158396 from Drosophila grimshawi 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0158396
Domain Number 1 Region: 374-470
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.34e-24
Family Ras-binding domain, RBD 0.0027
Further Details:      
 
Domain Number 2 Region: 513-620
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000911
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Weak hits

Sequence:  FBpp0158396
Domain Number - Region: 319-358
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.000131
Family beta-sandwich domain of Sec23/24 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0158396   Gene: FBgn0131946   Transcript: FBtr0159904
Sequence length 1229
Comment type=protein; loc=scaffold_14853:join(152064..152198,168410..169577,169656..171358,171549..172232); ID=FBpp0158396; name=DgriGH24490-PA; parent=FBgn0131946,FBtr0159904; dbxref=GB_protein:EDV91653,FlyBase:FBpp0158396,FlyBase_Annotation_IDs:GH24490-PA,REFSEQ:XP_001991946,FlyMine:FBpp0158396; MD5=7c20dd6c4caedb713b7cbdb2cc6c3ddf; length=1229; release=r1.3; species=Dgri;
Sequence
MDCGALAAQQQQLLQQQQKQQHQHHQKQQQNTLNCLAATTTTATNINQPASQEGIIVGLA
AGEGSVAVATVATGSSPQHKLLGLGEHLSGAGAVKLRKHSEQRTTTTTTPEVGATQQQKA
SYRISMANLEDTQESELDLILGELSLLEAQISYGEASFLPGNAAAAANAAPPPPPPAGIL
VGASLPPLPPPPPPPALASISAASSRTHSRTNSSISGDVSTSTSSSGISENGNGNGNGNG
NGNGNGLMLMMTPTNAALGPGMVPQTVGGGNATLLLGMGMGITLGVVTQREPRTESPDND
SAFSDTVSLLSSESSASSNTSLQQQQQQLQQQQQQQQHHHQHQQLQQQKLQQHQQQPMLA
SSKAAKIQLALHKLESASIRRLFVKAFTADGASKSLLVDERMVCGHVTRLLADKNHVQMQ
PTWSLIEHLADLHMERLFEDHELLVDNLMTWNSDAGNRVLFQQRSDKVSLFARPEHYLPG
PQMAPGCQHDEQTRHMLLEEFFELPHAQLQLQLEGPLYVKTDPKKAWKRHHFVLRPSGLY
YFPKEKTKNARDLVCLTLFSGHNVYTGIGWRKKCKSPTDYTFGFKAAGDSSLGKSCRSLK
MLCAEDGASLDRWLTAIRICKYGKQLWHNHKLLIEELCSTGGSNGTPGGVGGNGNGNGSG
IGSGSGTFASSMRSESISSISSAVPSQCGSVSSAVSSMSNSSSGRISRASSSSSSGCLSD
ENNAFDSEFTTGTIKRKPSMKPNLPLTTMTRQLKEVGEITTGAVGTTISPHTAADSSAAG
AGSPERSGTLTRRHSRRKSQESNGSNGGTLKRRPQVVPVKQRELVVATDAGNGNGGNSSS
SSNSTPTPTPSIICAKPATAAGAAAAAAAAQIQMGCLSDVELMCSSTLSLDSLPPPPPPL
PLALHADEQDVYGSQLSLASLPPPPPPEEVYVEATTPLTPTPMSMGMAMGMGLGVGLSMP
NSNGTLPPAVPAKPIKPAVKQTLKAAPPYKAPPDYVGPPASMGQQPIYSPGPLLPPRSDL
SRLSNGSDVNIANTSPKRLQESASNPPRDFLKDLQRVMRKKWQVAQKCKLEPATTPHEVL
GFRDFNNEDLLAAHNLNSGANSSHYYRETANVSHWVQEHYEYAHNEYALYENVHAQSNGA
ANATVTGMGMGMAMGAGAGIATAIPTAATGATGGCDDGRSCSSCAAAHISGGCNSGAAQK
TTTAAAAKTQRFHTSNASCLIPSRVSGSE
Download sequence
Identical sequences B4JLP2
FBpp0158396 7222.FBpp0158396 XP_001991946.1.65300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]