SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0158690 from Drosophila grimshawi 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0158690
Domain Number 1 Region: 884-977
Classification Level Classification E-value
Superfamily SH2 domain 2.83e-23
Family SH2 domain 0.0006
Further Details:      
 
Domain Number 2 Region: 998-1047
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000000222
Family SOCS box-like 0.0023
Further Details:      
 
Weak hits

Sequence:  FBpp0158690
Domain Number - Region: 294-345
Classification Level Classification E-value
Superfamily ARM repeat 0.000978
Family Armadillo repeat 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0158690   Gene: FBgn0132239   Transcript: FBtr0160198
Sequence length 1068
Comment type=protein; loc=scaffold_14853:join(6727697..6728089,6728191..6729413,6730402..6731354,6731433..6731545,6731619..6731787,6731868..6731958,6732085..6732192,6732261..6732393,6732464..6732487); ID=FBpp0158690; name=DgriGH24784-PA; parent=FBgn0132239,FBtr0160198; dbxref=GB_protein:EDV92205,FlyBase:FBpp0158690,FlyBase_Annotation_IDs:GH24784-PA,REFSEQ:XP_001992498,FlyMine:FBpp0158690; MD5=9d2bc8c004ba44e2bac63d3115bda731; length=1068; release=r1.3; species=Dgri;
Sequence
MESSIKLKESNNSNGNQNQSLNHNQMCNGNSNSSSHSNSTTNTTNNSNNSSSSIITSNAV
AVSICSSDSFSSMMPPTQPGTQRDHELVSANSIELNAAASLSDDSGVPLTTNSSISSGDS
YRIGMCKFEIEMVESDGEVSQFDSLDNCSEGGMSAENFNTLKKGPLAPIDPPPEFQDSPQ
TTLVRSISKNIVNSLRRWTSSQSSFEHLKDDVTMVSAAVASGTANQELVLLLAKPMVVET
HSKLLGSGDATAAVTAAAALVVSQHNSTHAEHQERTLKDSYAINKHLYSSDSILNSHTDN
IYDEPNNIISSSLGNSIDLLDEDDDDDDNDNDDDDDDDDDDEDDEAPSEPSSCSPSLPSP
PPPVSIIKIKQTLCPYYHDHTRYFKAIPTEQDSIASAKAAAAQQRFNSAGLSEIHDYDLY
YGARSRQPAMQSTQTQQQLPQQQQQQQQQQSSQDNSSLQRRQLLYSPLGHTSHCHYHHAH
HASHYHHPHHHHHHNHNHHHSHHPPPHQHHQHYQHGQRPNSRNSLNSRLSSSHNSLNVSG
EAEPLHMTLDEVKQFYHTLYSDAGKTSWSSGANKLLATTTATTITTSAATAATSIASAPK
ALGVKSSNETIWSVSTNTTNTTNTTNTTNTTTTTARTRSSTRASGYGAGVGGDSASKYLS
KQNKHNIDNDKLNNNNNNNINNINNASNYAQQQQQQQQPAATSAGSGQGSGAATSSDKLL
PEQHQQQQQQQLQLQPPNNKQLLQTEKKSQFSLNLKQKFCSIFRFRRSNNHSNRCRSNAQ
AATAAAVTAAAASAATNANTNVNGNAVTATTTAASCAVNAATDVEEVMNNCLNRIEPSAD
LRKKFQSRALPPLPKKAYAIDAAETEPEQEQKKSAAAQEPRALQFTSSIEKVKDYGWYWG
PLSSEAAEKVLSNEPDGSFIVRDSSDDHYIFSLSFKLNNCVRHVRIEQDQGTFSFGSYAK
FKSQTITEFIEKAVEHSRSGRYLFFLHRRPEHGPMRVQLTNPVSRFKHVQSLQHMCRFVI
LKAVIRKDLIQTLPLPRRLLDYLNYKHCYSEQVESDSSHSQISGEGSM
Download sequence
Identical sequences B4JNB2
XP_001992498.1.65300 7222.FBpp0158690 FBpp0158690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]