SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0128772 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0128772
Domain Number - Region: 157-174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0745
Family EGF-type module 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0128772   Gene: FBgn0102536   Transcript: FBtr0130280
Sequence length 488
Comment type=protein; loc=scaffold_4929:12257965..12259431; ID=FBpp0128772; name=Dere\GG10226-PA; parent=FBgn0102536,FBtr0130280; dbxref=FlyBase:FBpp0128772,FlyBase_Annotation_IDs:GG10226-PA,GB_protein:EDV58735,REFSEQ:XP_001969676,FlyMine:FBpp0128772; MD5=c52935e436891caa665e33726c3da7f4; length=488; release=r1.3; species=Dere;
Sequence
MVRSTILATHTQTPAAGLGRLAITKKLVLWLVLVLQVGFIGCIWLLQMSRGQESQQRSAV
DQSVGGRVNFVASGEAPMEKIALVGGTHCPHQQDNVNRYDRDFYQMKPERLNESHLPDYH
VPAYVDAEMGLTPTLWCYREGTINESQRLNDVDYLMAPPQCRCESGWHGRDCGQPEIIWR
ALMTSNRASKRGGSTPLQLVEASSTSLHRLFYMLELGAWDHLSLELLELQIRALIEVVDY
FLIYYVSNGSKERSLESMLGSQTSYTLLRCSSESNCSSSIAYSHFRRQLWQQCGVQMQAQ
DLLLHGDSGTVYAPAALKFLKYYAKDVLPLKFRLKYNVYGFYWQHPKKTLLNGVISSLGH
LHSAQMDAHRLRRLASSTLGDLNHYGGWNCELCLPPEQIVLLLQSSSHRKLPVKLPNDTR
NAHIDANYMQQLIANGVHIDGATQLHRLREQSEKYFAPEEALLHSSQYGQLLVNLYDVDV
LEDLQDED
Download sequence
Identical sequences B3N395
FBpp0128772 XP_001969676.1.56816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]