SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0129044 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0129044
Domain Number 1 Region: 837-885
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000195
Family Laminin-type module 0.0046
Further Details:      
 
Domain Number 2 Region: 1043-1091
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000698
Family Laminin-type module 0.0063
Further Details:      
 
Domain Number 3 Region: 991-1038
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000809
Family Laminin-type module 0.0014
Further Details:      
 
Domain Number 4 Region: 1094-1144
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000103
Family Laminin-type module 0.0081
Further Details:      
 
Domain Number 5 Region: 883-935
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000279
Family Laminin-type module 0.0065
Further Details:      
 
Domain Number 6 Region: 355-420
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000012
Family Laminin-type module 0.023
Further Details:      
 
Domain Number 7 Region: 529-567
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000781
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 8 Region: 789-830
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000977
Family Laminin-type module 0.0078
Further Details:      
 
Domain Number 9 Region: 288-357
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000184
Family Laminin-type module 0.048
Further Details:      
 
Domain Number 10 Region: 945-993
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000117
Family Laminin-type module 0.036
Further Details:      
 
Domain Number 11 Region: 437-480
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000215
Family Laminin-type module 0.0099
Further Details:      
 
Domain Number 12 Region: 1142-1189
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000363
Family Laminin-type module 0.034
Further Details:      
 
Domain Number 13 Region: 478-520
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000502
Family Laminin-type module 0.0074
Further Details:      
 
Weak hits

Sequence:  FBpp0129044
Domain Number - Region: 1569-1659
Classification Level Classification E-value
Superfamily Apolipophorin-III 0.000149
Family Apolipophorin-III 0.0012
Further Details:      
 
Domain Number - Region: 125-185
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000217
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0129044   Gene: FBgn0102806   Transcript: FBtr0130552
Sequence length 1786
Comment type=protein; loc=scaffold_4929:join(16735587..16738295,16738396..16741047); ID=FBpp0129044; name=Dere\GG10498-PA; parent=FBgn0102806,FBtr0130552; dbxref=FlyBase:FBpp0129044,FlyBase_Annotation_IDs:GG10498-PA,GB_protein:EDV59259,REFSEQ:XP_001970200,FlyMine:FBpp0129044; MD5=734622c7128127cc6d3230143e998936; length=1786; release=r1.3; species=Dere;
Sequence
MLELRLIVVIVLGLLSSQWDPVDSQRPPQHGRRDRPKYPPNKFIKTHPCERSSCYPATGN
LLIGRENRLTASSTCGLHSPERFCILSHLQDKKCFLCDTREETKQDPYKNHRIGQIIYKT
KPGTNLPTWWQSENGKENATIQLDLEAEFHFTHLIITFTTFRPAAMYIERSFDFGQTWHI
YRYFAYDCKESFPGVPTVLVNITDVMCTSRYSNVEPSRNGEVIFRVLPPNINVTDPYAEH
VQNQLKMTNLRIQMTKLHKLGDNLLDSRLENEEKYYYGISNMVVRGSCSCYGHASQCLPL
DPAFSQADNEDGMVHGRCECTHNTKGMNCEECEDFFNDLPWKPAFGKKTNACKKCECNDH
AVSCHFDEAVFTASGFVSGGVCDNCLHNTRGQHCEECMPYFYRDPEQDITSDSVCQPCDC
DPQGSSDDGICDSLNDPEDGALAGACHCKAFVTGRRCNKCKDGYWNLQSDNPEGCEPCTC
NILGTENNSGCVMRTGECKCKKYVTGKDCNQCMPETYGLSESPEGCSLCNCDAGGSYDNY
CDVISGQCRCRPHMTGRSCSQPKQNYFIPLLPEVHEAEVVDECISYGANGNCSLVAETPD
GSFTGIGFTRVPENSELVFTVGDIPRSMPYDAVIRYQSTSRGDWEDAFITLVRPDQVDPE
GGCGELATATSSETRIPFSLPDRSRQVVALNEVCLEAGKVYKFRIYFERKRHDVDSPTAT
ILVDSLTLIPRIDVTPILQGSVLADIRKKDYEKFNCKSSLYDMNYKSDPKCQNLDNILSV
FVHDGASMCNCNPTGSLSKECESNGGHCQCKPNVVGRQCDLCAPGTYGFGPEGCKACDCN
SIGSKDNNCDVITGQCQCVPNTYGRECNQCQPGYWKFPECQVCQCNGHAATCDPIQGTCI
DCQDSTTGYSCESCLDGYYGNPLFGSEIGCRACRCPETVASGMAHADGCSLDTRNNNMLC
HCQEGYSGPRCEICADNFFGNPDNGGTCSKCECSNNVDLYDTGNCDRQTGACLKCLYQTT
GDHCELCKDGFFGDALQQNCQQCDCDFLGTNNTIAHCDRYTGQCPCLPNVQGVRCDQCAE
NHWKIASGEGCESCNCDPIGALHEQCNSYTGQCQCKPGFGGRACNQCQAHYWGNPNEKCQ
PCECDQFGAADYQCDRETGNCVCHEGIGGYKCNECARGYIGQFPHCSPCGECFNNWDLIL
SALEDATTATILRAKEIKQVGATGAYTSEFSELDKKLQHIRNLLQNTSVSLVDIEKLDQE
TQSLRDQLQASHGRLSETELSLDHIYNSLSLSGVELESLQNHSRLVQQLSKELKENGIQL
QESNIEGALNLTRHAYERVSNLSTLKDEANEQASNTDRNCKRVENLSNKIQAEADDLANN
GKLIADYRVELASLTSQIPVLNNQVCGKPGDPCDSLCGGAGCGHCGGFLSCEHGAKTHSE
EALKVAKDAELAITSKKDQADQIIRALTQAKLNASEAYEKAKRGFEQSERYLNQTNANIK
LAENLFSALNNFQENKTASPSESKEVAQKTLDLDLKLEPEEIESLGDQINRAVSSLKDVE
AIIYRTKPDLDRVNNLQSIANATKEKADKILDSANSVVESLAAADESQAKAKDAIQQANS
NIELAGQDLEKIDEETYSAEAPANNTAQQVEKLAKKVQKLQNNIIKNDRDAKEITKEANS
VKLEAMRARGEANNLQSATSATNQTLTDRASRSENARERAKQLLQRASKLTVDTNAKLKD
LNDLQTVYLNKNQELLRLQDEIGPLNKVLNEHLIHIKERGSHYRQC
Download sequence
Identical sequences B3N6P3
FBpp0129044 XP_001970200.1.56816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]