SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0129056 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0129056
Domain Number 1 Region: 1582-1857
Classification Level Classification E-value
Superfamily Kelch motif 1.83e-40
Family Kelch motif 0.012
Further Details:      
 
Domain Number 2 Region: 364-630
Classification Level Classification E-value
Superfamily Kelch motif 8.5e-30
Family Kelch motif 0.014
Further Details:      
 
Domain Number 3 Region: 26-144
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.05e-21
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 4 Region: 1304-1352
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000167
Family Laminin-type module 0.021
Further Details:      
 
Domain Number 5 Region: 213-268
Classification Level Classification E-value
Superfamily Kelch motif 0.0000012
Family Kelch motif 0.0098
Further Details:      
 
Domain Number 6 Region: 1181-1216
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000131
Family EGF-type module 0.009
Further Details:      
 
Domain Number 7 Region: 1371-1486
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000183
Family Spermadhesin, CUB domain 0.007
Further Details:      
 
Domain Number 8 Region: 2298-2347
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000197
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 9 Region: 2351-2424
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000347
Family Laminin-type module 0.046
Further Details:      
 
Domain Number 10 Region: 1257-1304
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000558
Family Laminin-type module 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0129056   Gene: FBgn0102818   Transcript: FBtr0130564
Sequence length 2888
Comment type=protein; loc=scaffold_4929:join(16949141..16949497,16949798..16950214,16950293..16952215,16952370..16954760,16954834..16957252,16957318..16958477); ID=FBpp0129056; name=Dere\GG10510-PA; parent=FBgn0102818,FBtr0130564; dbxref=FlyBase:FBpp0129056,FlyBase_Annotation_IDs:GG10510-PA,GB_protein:EDV59292,REFSEQ:XP_001970233,FlyMine:FBpp0129056; MD5=83aea407e3d136ece4a03e8406c54499; length=2888; release=r1.3; species=Dere;
Sequence
MYALLATLTFWTLVLQTEQAHPSPSPSAPCDRSRKVFTEPYGEISDGPSGFNYTQDSHCE
WLIKARNDSQYITLTFHSMGTECSYDYIYVYDGDSFNSTLLGSFSGRTQPQRLVARSGSM
LILMYSDTNYVLDGFRASYYISNCLNNCHNHGKCVGHQCVCHGEWVGPDCEDEACPQRCG
ESQGRGRCQKSICHCSRGFSGRLCDLSDHPAGSSWRWLATDAEGMTARAAHSAVYMEDED
ALYVFGGYDLNNVISTLQIYRFSTSQWEDEWGIALQSRRHFYHPQKIDHSLLKAVLHHKN
EDEAKLWGLNSDVSIFRTVLYTLAESNPSQRRTRSSLPLTIVNANSTNEELNEYLEDILE
EVTDHKPHGRYGHAADRVPGGFVIYGGKHANGSFYSDLWQYNNTESGGKWKQMAIRSAVK
PPALARHTLNAAGRYLYIFGGSLETGEFSSSVYRIPLPLSEDSQWELVQPRGGKTLDVRL
AAHSTVYYKATNSLIVFGGIMTSLARFSKLSDRIYAFQLDQMHWTEILYPRTALRDTNIP
RERAFHTATISGNYMVVFGGYTHRHNKDEICYDNQMYWYHLSCHIWINQVVSAEDSLYPK
SQGVFAHAAALRRNHTLLIVGGYHGNVNADLFAYELPQVLRVENTLYNPEISCRLHSSHT
ACLSNPECGWCSADSSCYGRTIGANCTTNLQTTRCPGICPSLGDCHSCLVHGSQWGKSSG
NKAAFSVASKLGLNECTWCVQNAKCHHRDDNYGICGDSSGWWGDKGTEIRRPSLCTSTDR
RPGLTYIKYHFPINYTMPDYVGIVNATMVDFASPPFTTYFEHKLEGEMLARLVGFVRPQH
QWNNSAIQVCTSYSSAVLRAGLGLYLDELVNVTTQSSNQSYCSNVQLPTTEQPFTIDFQA
RRRIGGNGIYNAYQKTKMELQHLHNGQLNAFTFEYLEPYYSGKCTQYSNCLHCLTDASCA
WCPLTNICHLRSVNETEVCKMETSDTFHWSYLISQPSQCSNCTNYVSCEACARSGECEWW
TEDARCGRIGKTNSSVRAVEQCPRSCRERHGCQECLGERGRCVWCEASAQCFSFSVYTSE
FQFGMCREWVDQVVSRQPQEITDQKPQTPHFLQQQCKSCEQHRNCSSCLRTLSCGWCFDR
DNPIEGICMQGDFSYSAGNCSLALNSSSHHDAEWAYAQCPDVDECGLGLHDCHKEAKCTN
TQGSYNCHCRRGYIGDGKFSCVRTCYELCQNGNCSGPPDYTCRCALGWTGADCGLSCGCN
NHSTCNERLGKCDQCQDWSEGEKCERCRQGSYGNATAPHGCLPCECNGHGNQDLGVCNVS
NGECYCKDNTQGLNCELCAPGYYGDPRGGGKCYYQCESRGILTNIGKSAIGSYQSYRSPW
GASLEVKECLWILQPKTLQAEKSLLQLEFQWQSLAMDCDENAVYIYDSLPDLTGATQQNQ
LLAVVCAPYSSARIIEARSSHVTVHYKQGTERRHFGFNALYSVMNCVAGSCIPPHICDTQ
QRCVCPSGYVGASCEIEICPSNCNAKRMQGFCDTEYGRCICSNANYAGADCGTLVQRNHL
VITELFNTQLLSESLEHLRKTIPRFGHSVNADRRGSLWMFGGYSPNHGPLNDFRQFDTKN
STWLQVTVESSTPEDRMPLGRYFHASEIYVKKQIIYIYGGIGASSQLLNDFWMFSIQNQR
WSQIKVEVEPSEADYQVDVPPPLAGHTLTHLRYQEHESLILLGGLSLNKSRPLELWEFNL
DTGRWQELAAVGARMPVLYGHTSVYHPETNSVYLFGGYSTEPQSNLYALDLQKLSWTELP
SFRELNSPASLLPRARYFHSAVTTEHYMILYGGRTQPFNGTDVLIAYVYACNQWVRLTED
VELIGRVPASSYAEDMAIEPDTGAIYVIGGWDGSSTHSHVTKITLPDDICQLWSNGKYQC
RHYMGCSYCTIQNTYSYSSHCFSHGRTPCANHNGTLVVNNGAACDDDWMASRNCSSFATC
GACLAAWPTHQEVAPVCHWCDDCGIRGRCVPAGVDCGRRSAWCNKELSVGVLGLCPLPQC
YQLSCESCMLQPQCNWARNELGTVECIAKELVEKNQYRVVESCPPPCHTYENCSLCLSQT
PTQDHQECKWSTMLNLCLTPGSQPLLCAGGVCGLVLEASELKRCPEPCHVYTQCSSCLEH
AHCGWCAREGYNGDGICTEGALEHKQEHPSGSTCDLIYASWRNDSHLTHADVVSWHYVQC
PAENECINGHHNCDTVSEQCIDLDTAVGYKCVCAQGYREEQGACLPVCSQGCVRGNCVSP
EQCQCDFGYVGANCSIQCLCNGHSNCESSSRLDICLECHNNTMGEQCEKCQPLFVGNPRE
GHACQPCLDYCHGHSDVCVAYDADPAVFNMTRSDLERILQEGPAYNATCLRCGNHTAGDR
CDSCLTGYFRGSEDLHKECRPCQCHGHGNICDPVTGEKCNCANNTESDATCTAGGGKNSA
QLCWMVQCSKCRDSYAGNPTDGHQCYKQITVESRMCFDAKPIEECKSKPAALKPGQTVFF
VIQPRFMNVDIRIIIDVTQGELDVFMSPQDDSFIVETNETTGYHEIFLDNRYNWGPKIKR
EHPLNVALPRHDNVTIQKLFSPERRIGGGGLGGERIGANTYYVPQLQDCKSHGGHNFIVK
DQHAKDLSTHVTLNHCNTLLRLFGLKNRLVLTLPQHAHNLSATRFFIALRASSGPEPSYG
SVVFRQDQLHIDLFVFFSVFFSCFFLFLAVCVIVWKVKQAADLRRARRQHVVEMLHLAKR
PFAQIFLASSGLDMDSPQPTSSSSSARAMRQRARQALLLQEQSAGDSQSVMHHSTRRQSS
RIMMVAIEPTFDNLAAVGTVFISLPGRSRAPLSIALGSTLISYSRQYPLNTRHFMRAQRG
QNVANHPA
Download sequence
Identical sequences FBpp0129056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]