SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0129824 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0129824
Domain Number 1 Region: 1043-1250
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.1e-26
Family Laminin G-like module 0.016
Further Details:      
 
Domain Number 2 Region: 1264-1431,1460-1481
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.68e-16
Family Laminin G-like module 0.015
Further Details:      
 
Domain Number 3 Region: 1524-1547,1616-1771
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000119
Family Laminin G-like module 0.042
Further Details:      
 
Domain Number 4 Region: 89-252
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000274
Family Laminin G-like module 0.019
Further Details:      
 
Domain Number 5 Region: 842-884
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000821
Family EGF-type module 0.01
Further Details:      
 
Domain Number 6 Region: 727-770
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000907
Family EGF-type module 0.0033
Further Details:      
 
Domain Number 7 Region: 1835-1879
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000262
Family EGF-type module 0.0054
Further Details:      
 
Domain Number 8 Region: 1874-1911
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000511
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 9 Region: 424-461
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000712
Family EGF-type module 0.0056
Further Details:      
 
Domain Number 10 Region: 765-807
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000117
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 11 Region: 944-987
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000134
Family EGF-type module 0.0048
Further Details:      
 
Domain Number 12 Region: 1992-2036
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000143
Family EGF-type module 0.0037
Further Details:      
 
Domain Number 13 Region: 803-845
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000175
Family EGF-type module 0.0043
Further Details:      
 
Domain Number 14 Region: 385-428
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000943
Family EGF-type module 0.0034
Further Details:      
 
Domain Number 15 Region: 652-707
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000133
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 16 Region: 348-384
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000309
Family EGF-type module 0.025
Further Details:      
 
Domain Number 17 Region: 464-498
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000116
Family EGF-type module 0.0097
Further Details:      
 
Domain Number 18 Region: 304-344
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000144
Family EGF-type module 0.0064
Further Details:      
 
Domain Number 19 Region: 1915-1959
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000182
Family EGF-type module 0.008
Further Details:      
 
Domain Number 20 Region: 266-302
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000042
Family EGF-type module 0.024
Further Details:      
 
Domain Number 21 Region: 1956-1996
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000553
Family EGF-type module 0.018
Further Details:      
 
Domain Number 22 Region: 1802-1840
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000201
Family EGF-type module 0.013
Further Details:      
 
Domain Number 23 Region: 2031-2069
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000712
Family EGF-type module 0.012
Further Details:      
 
Domain Number 24 Region: 2071-2113
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000015
Family EGF-type module 0.01
Further Details:      
 
Domain Number 25 Region: 982-1022
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000255
Family EGF-type module 0.0083
Further Details:      
 
Weak hits

Sequence:  FBpp0129824
Domain Number - Region: 1525-1582
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000127
Family Growth factor receptor domain 0.0096
Further Details:      
 
Domain Number - Region: 591-622
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000246
Family EGF-type module 0.0085
Further Details:      
 
Domain Number - Region: 924-948
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000858
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 880-900
Classification Level Classification E-value
Superfamily EGF/Laminin 0.012
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0129824   Gene: FBgn0103579   Transcript: FBtr0131332
Sequence length 2188
Comment type=protein; loc=scaffold_4820:complement(7921249..7921479,7921546..7921959,7922024..7922148,7922216..7923976,7924047..7924229,7924295..7925066,7925128..7925322,7925387..7925492,7925553..7926097,7926413..7926945,7928013..7928141,7928269..7929261,7929622..7929966,7939502..7939736); ID=FBpp0129824; name=Dere\GG11278-PA; parent=FBgn0103579,FBtr0131332; dbxref=FlyBase:FBpp0129824,FlyBase_Annotation_IDs:GG11278-PA,GB_protein:EDV53878,REFSEQ:XP_001982008,FlyMine:FBpp0129824; MD5=58c309033c9bffdbaba9359b8e390e2b; length=2188; release=r1.3; species=Dere;
Sequence
MAIIANASLPQQHKQRQATTTTTTTTVAASVETATTTARSRDRTKSAAQITSHLLKRAIS
VYSSPQWIPLFILIYLATDVASVAVPTKEAYFNGSTYLRLTTPMPIWDHSAISFRSCRGG
EILAQQYNKNSIVISVLNDFLQISLAGPAVHGPNNRLDVKLPYQLLDNRWHTLQFKYEYG
NLYLHVDRAASIFANSTYNSQFLTNQDIGYKDAILILGNSFSGCLLDGPGLQFVNNSTVQ
NVVFGHCPLTPGPCSDHDLFTRLPDNFCLNDPCMGHGTCSSSPEGYECRCTARYSGKNCQ
KDNGSPCAKNPCENGGSCLENSRGDYQCFCDPNHSGQHCETEVNIHPLCQTNPCLNNGAC
VVIGGSGALTCECPKGYAGARCEVDTDECASQPCQNNGSCIDRINGFSCDCSGTGYTGAF
CQTNVDECDKNPCLNGGRCFDTYGWYTCQCLDGWGGEICDRPMTCQTQQCLNGGTCLDKP
IGFQCLCPPEYTGELCQIAPSCAQQCPIDSECVGGKCVCKPGSSASDLEPLTPLELDILD
ATLCPSEKKKRYISPEWLKRKRCELKLSYNCQTSTGDGAAALALTPINCNATNGKCLNGG
TCSMNGTHCYCAVGYSGDRCEKAENCSPLNCQEPMVCVQNQCLCPENKVCNQCATQPCQN
GGECVDLPNGDYECKCTRGWTGRTCGNDVDECTLHPKICGNGICKNEKGSYKCYCTPGFT
GVHCDSDVDECLSFPCLNGATCHNKINAYECVCQPGYEGENCEVDIDECGSNPCSNGSTC
IDRINNFTCNCIPGMTGRICDIDIDDCVGNPCLNGGQCIDQLGGFRCDCSGTGYEGENCE
LNIDECLSNPCTNGAKCVDRVKDYFCDCHNGYKGKNCEQDINECESNPCQYNGNCLERSN
MTLYQMSRITDLPKVFSQPFSFENASGYECVCVPGIIGKNCEININECDSNPCSKHGNCN
DGIGTYTCECEPGFEGTHCEINIDECDRYNPCQRGTCYDQIDDYDCDCDANYGGKNCSVL
LKGCDENPCLNGGACLPYLINEITHLYNCTCENGFQGNKCEKTTTLSMVATSLISVTTER
EEGYDINLQFRTTLPNGVLAFGTTGEKNEPVSYILELINGRLNLHSSLLNKWEGVFIGSK
LNDSNWHKVFVAINTSHLVLSANDEQAIFPVGSYETANNSQPSFPRTYLGGTIPNLKSYL
RHLTHQPSAFVGCMQDIMVNGKWIFPDEQDANVSYTKLENVQSGCPRTEQCKPNPCHSNG
ECTDLWHTFACHCPRPFFGHTCQHNMTAATFGHENTTHSAVIVETTDVARRAIRSILDIS
MFIRTREPTGQVFYLGTDPRKAPTKNIGDSYVAAKLHGGELLVKMQFSGTPEAYTVGGQK
LDNGYNHLIEVVRNQTLVQVKLNGTEYFRKTLSTTGLLDAQVLYLGGPAPTRESLLGATT
EPGVIPVPGAGVPIEDTTVPKEADDSRDYFKGIIQDVKVSNGSLNLIVEMYSLNVTDVQV
NAKPLGAVTIDRASVLPGEVSDDLCRKNPCLHNAECRNTWNDYTCKCPNGYKGKNCQEIE
FCQHVTCPGQSLCQNLDDGYECVTNTTFTGQERSPLAFFYFQEPQSDDIVSEAAPKQTLK
PVIDIAFRTRAGGTLLYIDNVDGFFEIGVNGGRVTITWKLSALHFGESARFEKENTDGEW
SRIYLRAHNSKLEGGWKGWESMVDPTPAFSTDIDQAAFQSLIATSTQVYLGGMPESRQAR
GSTLSAQQGSQFKGCVGEARVGDLLLPYFSMAELYSRTNVSVQQKAQFRLNATRPEEGCI
LCFQSDCKNDGFCQSPSDEYACTCQPGFEGDDCGTDIDECLNTECMNNGTCINQVAAFYC
QCQPGFEGQHCEQNIDECAEQPCHNGGNCTDLIASYVCDCPEDYMGPQCDVLKQMTCENE
PCRNGSTCQNGFNAATGNNFTCTCVPGFEGPLCDIPFCEITPCDNGGLCLTTGAVPICKC
SLGYTGRLCEQDINECESNPCQNGGQCKDLVGRYECDCQGTGFEGIRCENDIDECSVEGD
YCGGLGRCFNKPGSFQCICQKPYCGAYCNFTDPCNATDLCSNGGRCVESCGAKPDYYCEC
PEGFAGKNCTAPITAKEDGPSTTDIAIIVIPVVVVLLLIAGALLGTFLVMARNKRATRGT
YSPSAQEYCNPRLEMDNVLKPPPEERLI
Download sequence
Identical sequences B3P758
FBpp0129824 XP_001982008.1.56816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]