SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0129860 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0129860
Domain Number 1 Region: 139-338
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.31e-53
Family Astacin 0.00015
Further Details:      
 
Domain Number 2 Region: 489-587
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-35
Family Spermadhesin, CUB domain 0.0003
Further Details:      
 
Domain Number 3 Region: 802-910
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-35
Family Spermadhesin, CUB domain 0.00047
Further Details:      
 
Domain Number 4 Region: 635-752
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-31
Family Spermadhesin, CUB domain 0.00028
Further Details:      
 
Domain Number 5 Region: 910-1027
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.06e-28
Family Spermadhesin, CUB domain 0.00065
Further Details:      
 
Domain Number 6 Region: 336-362,389-481
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-22
Family Spermadhesin, CUB domain 0.0031
Further Details:      
 
Domain Number 7 Region: 588-633
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000243
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 8 Region: 752-796
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000234
Family EGF-type module 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0129860   Gene: FBgn0103615   Transcript: FBtr0131368
Sequence length 1068
Comment type=protein; loc=scaffold_4820:complement(7479352..7480298,7480360..7480928,7480991..7481252,7481312..7482132,7482184..7482528,7482674..7482735,7482796..7482996); ID=FBpp0129860; name=Dere\GG11314-PA; parent=FBgn0103615,FBtr0131368; dbxref=FlyBase:FBpp0129860,FlyBase_Annotation_IDs:GG11314-PA,GB_protein:EDV53817,REFSEQ:XP_001981947,FlyMine:FBpp0129860; MD5=5ae84098b43cc84778cdb2758eb14384; length=1068; release=r1.3; species=Dere;
Sequence
MKGMRLIPMKMKANLVVLSVGALWTIMMVFLVDSAEGRRLSQQPESECDFDFKEQPEDFF
GLLDSPQVPPKEPKDDIHPLKADGQYSGRRRKQGHKSRDKAAPRLPPPFLWTDDSVDVLQ
HSHSPTLHGKAVQRRRRAVTVRKERTWDYGVIPYEIDTIFSGAHKALFKQAMRHWENFTC
IKFVERDANLHANYIYFTVKNCGCCSFLGKNGNGRQPISIGRNCEKFGIIIHELGHTIGF
HHEHARGDRDKHIVINKANIMRGQEYNFDVLSPEEVDLPLLPYDLNSIMHYAKNSFSKSP
YLDTITPIGIPHGTHLELGQRRRLSRGDIVQANLLYKCASCGRTYQQNSGHIVSPHFVYS
GNGVLSEFEGSGDAGEDPSAGSEFDASLTNCEWRITATNGEKVILHLQQLHLMSSDDCTQ
DYLEIRDGYWHKSPLVRRICGNVSGEVITTQTSRMLLNYVNRNAAKGYRGFKARFEVVCG
GDIKLTKDQSIDSPNYPLDYMPDKECVWRITAPDNHQVALKFQSFELEKHDGCTYDYVEI
RDGNHSDSRLIGRFCGDKLPPNIKTRSNQMYIRFVSDSSVQKLGFSAALMLDVDECKFTD
HGCQHLCINTLGSYQCGCRAGYELQANGKTCEDACGGVVDATKSNGTLYSPSYPDVYPNS
KQCVWEVVAPPNHAVFLNFTHFDLEGTRFHYTKCNYDYLIIYSKMRDNRLKKIGIYCGHE
LPPVVNSEQSVLRLEFYSDRTVQRSGFVAKFVIDVDECSMNNGGCQHRCRNTFGSYQCSC
RNGYTLAENGHNCTETRCKFEITTSYGVLQSPNYPEDYPRNIYCYWHFQTVLGHRIQLTF
HDFEVESHQECIYDYVAIYDGRSENSSTLGIYCGGREPYAVIASTNEMFMVLATDAGLQR
KGFKATFVSECGGYLRATNHSQTFYSHPRYGSRPYKRNMYCDWRIQADPESSVKIRFLHF
EIEYSERCDYDYLEITEEGYSMNTIHGRFCGKHKPPIIISNSDTLLLRFQTDESNSLRGF
AISFMAVDPPVDSVGEDFDAVTPFPGYLKSMYSSETGSDHLLPPSRLI
Download sequence
Identical sequences B3P6Z7
XP_001981947.1.56816 FBpp0129860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]