SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0129919 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0129919
Domain Number - Region: 717-759
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000328
Family EGF-type module 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0129919   Gene: FBgn0103673   Transcript: FBtr0131427
Sequence length 969
Comment type=protein; loc=scaffold_4820:complement(7005135..7006248,7006306..7007533,7007810..7007949,7008009..7008120,7008181..7008496); ID=FBpp0129919; name=Dere\GG11373-PA; parent=FBgn0103673,FBtr0131427; dbxref=FlyBase:FBpp0129919,FlyBase_Annotation_IDs:GG11373-PA,GB_protein:EDV53721,REFSEQ:XP_001981851,FlyMine:FBpp0129919; MD5=8712716a21c85a22c5b08804896bda41; length=969; release=r1.3; species=Dere;
Sequence
MIQILTHRPNFSPLVVFMLLLIDQRLIVDSSVPVLQNPSDEYTKYVPIEELKLPEDQELV
VRLPSNSLLKYTSYKDVSILHFDVPPDSRTAYFTFKAFEDPKSAFQRKCKPKDVTLHLKA
SSYPVISPENITFPKNFFTKDQRFKVYDLQFLSNEQQQRITIEGPHIGNWFAVAFVSWSD
PNNDRIEQQGLAASCDTLLSAEMSVSRFRPIIINNGQEHQDNLTSQVLPELNGANMTSLK
DALNTSRPLRSIPPKQQKPKAASKSLPEGKPSRAAQLQNITENHNSTPTANNEIIYRFYV
PDDIGDATARIIFDQVCDECPPVGFHVRANGYPLGGTDHNHGHGTIIRPNQTTEISIPFG
VQPNSWHYALLTFVNEADESEMPSQGDSSLTNHSLSFVLQIDYITEDADSLMQKSKSVQN
NTNSSSANPWEPTKFRQMNFYSLLRQTYREFFMFDYDLRPDVNGTVPDTLNLTAQTHSGF
AFDLGEVSDIGGTLTFALSMKEAHRASLKMSLPTQPPDLGGILAERLIGDPKEQVMPVVS
ATSNQSMQIVVCMQLGEPGEPVYPDKCRYGQRLNQASIVVNNTESMGLVHVPFPESGRWY
VTMGLFCHGSGTARVSIMESVKEFIRKHQDMLADMRSPCDCAESVPRYTSCLKSPDCLEA
MNETETLKVKECMMDDKCSTNFKQMTRLFVEHHKAAMEQHVAVENCNTSVVFSVSSSPCV
AGRCGRFGRCYHYMSGGFVFSTCVCSKGYRGWDCTEDSQVPTNMSILLATLLLTLSNLLF
FPSIYMAVKRRYYTEGVIYFFAMFFSIFYHACDAGEDEYSFCLVKIGVLQFCDFYCGLLS
IWVTLVAMAHVRSEFVSLLHMFGAILLAFGTELNKQSLWVFLAPALTGICLISTSWGLRC
AKSRKLFPSRRYLSVWLPFGLTLVIAGLVCYAFLQTKQNYHIVHSIWHMVMALSILCLLP
SKKSFLPKC
Download sequence
Identical sequences B3P6Q1
FBpp0129919 XP_001981851.1.56816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]