SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0130652 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0130652
Domain Number 1 Region: 419-632
Classification Level Classification E-value
Superfamily Kelch motif 7.06e-29
Family Kelch motif 0.0054
Further Details:      
 
Domain Number 2 Region: 291-400
Classification Level Classification E-value
Superfamily Kelch motif 6.28e-16
Family Kelch motif 0.0084
Further Details:      
 
Domain Number 3 Region: 83-217
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000000107
Family Spermadhesin, CUB domain 0.0024
Further Details:      
 
Domain Number 4 Region: 949-996
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000276
Family Laminin-type module 0.037
Further Details:      
 
Weak hits

Sequence:  FBpp0130652
Domain Number - Region: 224-250
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000586
Family Integrin beta EGF-like domains 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0130652   Gene: FBgn0104398   Transcript: FBtr0132160
Sequence length 1323
Comment type=protein; loc=scaffold_4820:join(4605292..4605563,4608773..4609009,4609080..4609237,4609296..4609443,4609786..4612615,4612677..4612763,4612930..4613011,4613075..4613232); ID=FBpp0130652; name=Dere\GG12106-PA; parent=FBgn0104398,FBtr0132160; dbxref=FlyBase:FBpp0130652,FlyBase_Annotation_IDs:GG12106-PA,GB_protein:EDV53398,REFSEQ:XP_001981528,FlyMine:FBpp0130652; MD5=8dbc8bf56b02dfa1a81e8ab2ffc9e2d6; length=1323; release=r1.3; species=Dere;
Sequence
MCLAAEPPQKQPNRSSTSPTFNAKYRRKCLLLLTLLLFHGCFSGLHRAAAFNCTAHGGRC
QNDGQCQEDGQCLCADGWQGPECQFCGGKVRMYHPMGTIHDGWGNYSVSVKCSWLIDARH
PHWNRRHNTNPSRTANIRIHLREFATECGWDHLYIYDGDSVDSPLLAVFSGLMYRGNFSI
RRVPQVIARSGTALVHFFSDDAYNMSGFNLTYKMNGCPSDSDEVECSGHGKCRDGDCICD
PMFRGEACNIAACPNNCLESKNQGHCRLDQERCSCYEGFAGDDCSQISAHGAWSTVHPKH
SPTPAGSASHGATIWQDKLHIVGGESYGRGELMSTYDFNGNVWETVHPEDGSDVPDKRYG
ASTVMYGGKIFMYGGVVKGHGISNELWAFDASARAWANISVRADPSCNATGGISAMCGPL
HVVGHTATLVPGYGDKNNYQYMVVIFGHSPNYGYLNTVQEFNFASREWRIVPTTGYVVKG
GYGHSAAYDFLTEKVYVYGGIVSESESSQVLSSRLYAYEPATRVWSLLSAAPSARLLHTA
NFVNHGLMMVFGGNTHNDTSQSYGAKCYSQDLLVYDVYCDSWHYHPMPGHLQADLARFGH
SSVVFEESLYIYGGFNGQLLNDMLRYQPGYCSYYTKQEKCTAARPGVKCIWDVQKMRCIA
ITQVQRSAIYGREQYDYVACPSKSRLTLTSELLHDVHRCQELASCQSCVSTAFGCTYCGN
GVCSKDRCRETTSMASVFFESSTQLAVSTVSPPLNAKHLDSCPIAEEHLVSSVCEQLHNC
RACFANLACRWDSEHNRCKSYTFYGGMALNRTQDEVSCSPSCATLTNCQNCTEDECIWCQ
NEQRCVDRNAYTASFPYGQCREWTTFTAKCRSAPIQSTALAVGSTTALSSAQCGYYNSCQ
MCLDDPACGWCDNGSNTGLGRCVVGGALAPYDETECALKHWFFTSCPRCNCNGHSYCNDQ
QHCEQPCNNLTTGAHCEKCRTGYWGNPINGGKCQRCDCNGQGVYCHPDTGKCFCTTKGIV
GDHCEKCDSQNHYHGDPLKGSCYYELTIDYQFTFNLSKKEDRHFTQINFRNSPGKPEIDA
DFTITCSVPAKMDISVKRAGSPDMLILVGVNCSTFRHRFPKTDYQFGHSPDDNSSLTTFY
VFVHDFQPPIWIQIAFSQYPKLNLQQFFITFSSCFLLLLLMAAVLWKIKQKYDMFRRRQR
LFVEMEQMASRPFSQVLVDIENRESIDLSLTLEGIGHLSKKRKKECPSPIALEPCSGNRA
AVLSLLVRLPTGGLSQAPSGQSAGLAVASALVTLGNPRRPSIDQHPKEPKSKRKQSQHPD
SCT
Download sequence
Identical sequences B3P5Z8
XP_001981528.1.56816 FBpp0130652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]