SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0130680 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0130680
Domain Number 1 Region: 579-689
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000105
Family Growth factor receptor domain 0.0066
Further Details:      
 
Domain Number 2 Region: 490-533
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000787
Family EGF-type module 0.0043
Further Details:      
 
Domain Number 3 Region: 916-956
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000286
Family EGF-type module 0.0061
Further Details:      
 
Domain Number 4 Region: 798-835
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000954
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 5 Region: 879-921
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000164
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 6 Region: 687-723
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000839
Family EGF-type module 0.013
Further Details:      
 
Domain Number 7 Region: 838-882
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000115
Family EGF-type module 0.032
Further Details:      
 
Domain Number 8 Region: 356-390
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000147
Family EGF-type module 0.021
Further Details:      
 
Weak hits

Sequence:  FBpp0130680
Domain Number - Region: 472-494
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000254
Family EGF-type module 0.025
Further Details:      
 
Domain Number - Region: 767-802
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00401
Family EGF-type module 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0130680   Gene: FBgn0104426   Transcript: FBtr0132188
Sequence length 1407
Comment type=protein; loc=scaffold_4820:join(5019376..5019612,5022574..5022691,5023163..5023350,5027173..5027227,5027705..5028020,5031120..5031253,5031379..5031554,5031791..5032034,5033382..5034110,5034411..5034605,5034669..5034764,5036011..5036382,5036484..5037091,5037206..5037961); ID=FBpp0130680; name=Dere\GG12134-PA; parent=FBgn0104426,FBtr0132188; dbxref=FlyBase:FBpp0130680,FlyBase_Annotation_IDs:GG12134-PA,GB_protein:EDV53447,REFSEQ:XP_001981577,FlyMine:FBpp0130680; MD5=c42d658250e824c19c6cd96d0a33a349; length=1407; release=r1.3; species=Dere;
Sequence
MYKMFRKHFRRKPTSSSSAESTIESPDSLGMSKKTATKRQRPRHREPKIATLPSTVRDCR
SLKSACNLIALILILLVHKISAAGNFELEILEISNTNSHLLNGYCCGMPAELRATKTIGC
SPCTTAFRLCLKEYQTTEQGASISTGCSFGNATTKILGGSSFVLSDPGVGAIVLPFTFRW
TKSFTLILQALDMYNTSYPDAERLIEETSYSGVILPSPEWKTLDHIGRNARITYRVRVQC
AVTYYNTTCTTFCRPRDDQFGHYACGSEGQKLCLNGWQGVNCEEAICKAGCDPVHGKCDR
PGECECRPGWRGPLCNECMVYPGCKHGSCNGSAWKCVCDTNWGGILCDQDLNFCGTHEPC
KHGGTCENTAPDKYRCTCAEGLSGEQCEIVEHPCATRPCRNGGTCTLKPSNRTQAQVYRT
SHGRSNMGRPVRRSSSMRSLDHLRPEGQALNGSSSSGLVSLGSLQLQQQLAPDFTCDCAA
GWTGPTCEINIDECAGGPCEHGGTCIDLIGGFRCECPPEWHGDVCQVDVNECEAPHSAGI
AANALLTTTATAIIGSNLSSTALLAALTSAVASTSMAIGPCINAKECRNQPGSFACICKE
GWGGVTCAENLDDCVGQCRNGATCIDLVNDYRCACAAGFTGRDCETDIDECATSPCRNGG
ECVDMVGKFNCICPLGYSGSLCEEAKENCTPSPCLEGHCLNTPEGYYCHCPPDRAGKHCE
QLRPLCSQPPCNEGCFANVSLATSATTTTTSTTSATTTRKMAKPSGLPCSGHGSCEMSDV
GTFCKCHVGHTGTFCEHNLNECSPNPCRNGGICLDGDGDFTCECMSGWTGKRCSERATGC
YAGQCQNGGTCMPGAPDKALQPHCRCTPGWTGLFCAEAIDQCRGQPCHNGGTCESGAGWF
RCVCAQGFSGPDCRINVNECSPQPCQGGATCIDGIGGYSCICPPGRHGLRCEILLSDPKS
ACQNASNTISPYTALNQSQNWLDIALTGRSEDDENCNACVCENGTSRCTNLWCGLPNCYK
LDPLSKSSNLSGVCKQHEVCVPALSETCLSSPCTVRGDCRALEPSRRVAPPRLPAKSSCW
PNQAVVNENCARLTILLALERVGKGASVEGLCSLVRVLLAAKLIKKPASTLGQDPGMLMV
LCDLKTGTNDTVELTVSSSKINDQQLSVAVGLLGELLSSRQLNGVQHRKELELQHAKLAA
LTSIVEVKLETARVADGSGHSLLIGVLCGVFIVLVGFSVFISLYWKQRLAYRTSSGMNLT
PSLDALRHEEEKSNNLQNEENLRRYTNPLKGSTSSLRAATGMELSLNPAPELAASAASSS
ALHRSQPLFPPCDFERELDSSTGLKQAHKRSSQILLHKTQNSDMRKNTVGSLDSPRKDFG
KRSINCKSMPPSSGDEGSDVLATTVMV
Download sequence
Identical sequences B3P843
XP_001981577.1.56816 FBpp0130680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]