SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0131156 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0131156
Domain Number 1 Region: 2332-2350,3478-3653
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.53e-37
Family Laminin G-like module 0.00047
Further Details:      
 
Domain Number 2 Region: 3959-4168
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.15e-27
Family Laminin G-like module 0.008
Further Details:      
 
Domain Number 3 Region: 3706-3908
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.56e-26
Family Laminin G-like module 0.002
Further Details:      
 
Domain Number 4 Region: 2805-2890
Classification Level Classification E-value
Superfamily Immunoglobulin 1.13e-16
Family I set domains 0.017
Further Details:      
 
Domain Number 5 Region: 2878-2977
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000629
Family V set domains (antibody variable domain-like) 0.056
Further Details:      
 
Domain Number 6 Region: 1292-1374
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000138
Family I set domains 0.043
Further Details:      
 
Domain Number 7 Region: 2707-2790
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000214
Family I set domains 0.011
Further Details:      
 
Domain Number 8 Region: 2417-2504
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000382
Family I set domains 0.029
Further Details:      
 
Domain Number 9 Region: 2609-2684
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000719
Family I set domains 0.032
Further Details:      
 
Domain Number 10 Region: 2512-2597
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000089
Family I set domains 0.019
Further Details:      
 
Domain Number 11 Region: 1256-1294
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000131
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 12 Region: 1047-1131
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000019
Family I set domains 0.015
Further Details:      
 
Domain Number 13 Region: 3094-3179
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000413
Family I set domains 0.018
Further Details:      
 
Domain Number 14 Region: 484-522
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000117
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 15 Region: 1212-1248
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000262
Family LDL receptor-like module 0.00058
Further Details:      
 
Domain Number 16 Region: 3187-3280
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000335
Family I set domains 0.067
Further Details:      
 
Domain Number 17 Region: 918-959
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000038
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 18 Region: 3308-3389
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000605
Family I set domains 0.042
Further Details:      
 
Domain Number 19 Region: 3387-3463
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000609
Family I set domains 0.035
Further Details:      
 
Domain Number 20 Region: 200-235
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000013
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 21 Region: 288-329
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000262
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 22 Region: 983-1022
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000746
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 23 Region: 1168-1208
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000089
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 24 Region: 839-876
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000406
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 25 Region: 614-650
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000785
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 26 Region: 711-747
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000114
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 27 Region: 879-913
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000144
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 28 Region: 3646-3688
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000154
Family EGF-type module 0.014
Further Details:      
 
Domain Number 29 Region: 2020-2069
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000206
Family Laminin-type module 0.0082
Further Details:      
 
Domain Number 30 Region: 33-68
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000249
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 31 Region: 534-572
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000262
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 32 Region: 73-109
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000288
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 33 Region: 116-157
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000458
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 34 Region: 435-472
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000511
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 35 Region: 804-837
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000798
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 36 Region: 653-690
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000314
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 37 Region: 1678-1725
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000628
Family Laminin-type module 0.049
Further Details:      
 
Domain Number 38 Region: 578-613
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000628
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 39 Region: 1983-2022
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000158
Family EGF-type module 0.059
Further Details:      
 
Domain Number 40 Region: 400-435
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000223
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 41 Region: 3018-3080
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000301
Family I set domains 0.016
Further Details:      
 
Domain Number 42 Region: 762-798
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000034
Family LDL receptor-like module 0.0016
Further Details:      
 
Weak hits

Sequence:  FBpp0131156
Domain Number - Region: 156-192
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000393
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number - Region: 1730-1774
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000791
Family Laminin-type module 0.01
Further Details:      
 
Domain Number - Region: 1612-1641
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00299
Family Laminin-type module 0.056
Further Details:      
 
Domain Number - Region: 2098-2135
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0117
Family Laminin-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0131156   Gene: FBgn0104898   Transcript: FBtr0132664
Sequence length 4180
Comment type=protein; loc=scaffold_4644:complement(2314681..2314723,2316602..2316749,2316816..2317232,2317297..2317997,2318067..2318992,2319055..2319327,2319425..2319633,2324264..2324438,2324508..2324745,2324836..2325292,2325435..2325835,2325903..2326080,2326476..2326738,2326808..2327411,2327670..2327850,2327983..2328125,2330267..2331341,2331410..2333646,2333765..2334151,2334427..2334516,2334599..2334692,2334775..2334908,2335664..2335741,2335966..2336196,2336303..2336530,2336865..2336990,2337730..2337972,2338375..2338572,2338929..2339045,2339280..2339365,2339798..2339930,2340086..2340235,2340586..2340747,2341255..2341348,2341685..2341833,2342447..2342914,2343495..2343620,2343804..2343917,2344014..2344145,2344370..2344492,2344893..2345003,2349015..2349114); ID=FBpp0131156; name=Dere\GG12610-PA; parent=FBgn0104898,FBtr0132664; dbxref=FlyBase:FBpp0131156,FlyBase_Annotation_IDs:GG12610-PA,GB_protein:EDV45629,REFSEQ:XP_001982660,FlyMine:FBpp0131156; MD5=4ab53360292653ee7a890825cef77050; length=4180; release=r1.3; species=Dere;
Sequence
MRDVCIFMSFVLSCHFDVDCWQCLHGRKSQAKNKCQSNEFRCNNGDCIDARKRCDNVSDC
SEGEDENEECPAACSGMEYQCRDGTRCISVSQQCDGHSDCSDGDDEEHCDGIVPKLRYTC
PKGKFTCRDLSCISIVHRCDGRADCPNDRSDEEGCPCLYDKWQCDDGTCITKELLCNGNI
DCPEDISDERYCEGGYDSEECRFDEFRCGTGECIPMRQVCDNIYDCNDYSDEVNCAEGEE
EDSVGIPIGHQPRRPPPKHEDWLHEMDTNEYHVYQPSNVYEKANSQNPCASNQFRCTTSN
VCIPLHLRCDGFYHCNDMSDEQSCEQYQRHPTTRRPLTLATISTIFTTQGPDLLERRNTT
RATEATRWPWATKQTTTTTTTSNPITTVGVANKLPQTCLENIEFACQNRDCISIESVCDG
TSDCVSNEDEDDALCKCSGDKYKCQRGGGCIPKSQVCDGKPQCRDRSDESACSNGGLNKP
RLGVQCLESQFQCGDGSCISGYKYCNGIHDCADASDEYNCIYVDTYDTEPGNNPLNSCDI
LEFECEDSQCLPIEKKCDGYADCDDMSDEFECQPNTDHCLESEFECDSYCLPLDQLCNGI
PNCQDGSDERNCTFCREDAYLCNTGECVADNQRCNGIADCGDGSDERHCARIHCPPNKLA
CNGTCVSRRIKCDGKRDCLDGYDEMYCAETNNHYPTQNVNVIRPKLGPNPIPKSCRPHEW
QCANLECIDHRLHCNNYKDCSDGSDEDLSVCFGTATTRLKPSDCSPDQFYCDESCYNRSV
RCNDHAECSDGSDEVGCSMKSLPCPQHQCPSGRCYSESERCDRHRHCEDGSDEANCTAIL
CKDNEFLCFDRQFCINATQQCDGYYDCRDFSDEQNCIGCYANQFRCNNGDCVADTAPCNG
YPECSDHSDELNCGANHECLPNQFRCNSGQCVSSSVRCNGRTDCQDSSDEQNCGHRHVEV
SQGLGTTGVFTTSSTSTTAMTPLRIICPPTSFKCENGPCILLALQCNGRVDCPYDGSDEA
DCGQISNDIDPVESSNGRKSNQLNLKTYPDSQIIKESREVTFRCRDEGPARARVRWTRPG
GRPLPPGFTDRNGRLEIPNIRVEDAGIYVCEAVGYASYIPGQQVTVNLNVERSWGENKYE
ELRSNRIRYGTVPHIDLEFFGLDNDAAFRPESACTEYQATCMNGECIDKTSICDGNPDCT
DGSDEQSCSLGLKCQPNQFMCSNSKCVDRTWRCDGENDCGDNSDEASCDPEPNGAPCRYS
EFQCRSGHCIPKSFQCDYVPDCMDGTDEVGCMAPLPIRPPPQSVALLEGEKLELTCVATG
TPTPTIVWRLNWGHVPDKCVSKSYGGTGTLRCPDMRPQDSGAYSCEIINTRGTHFVNPDT
IVTVTPVRTDVCEAGFFNMLARKSEECVKCFCFGVARACDSANLFTYAIHPPIMSHRVVS
VELSPIRQIVINEAAPGQDLLTLLHGVQFRATNVQFSGRETPYLALPTEYMGNQLKSYGG
NLRYEVNYSGSGRPVNGPDVIITGNRFTLTYRVRTQPGQNNRVSIPFVPGGWQKPDGRKA
SREEIMMILANVDNILIRLGYLDSTAREVDLINIALDSAGTADKGLGSASLVEKCTCPTG
YVGDSCESCASGYVRQPGGPWLGHCVPFIPEPCPSGTFGDPRRGVPCKECPCPLTGINNF
ASGCQQGPDGEVTCRCNEGYTGRRCEQCAAGYQGNPMAAGGVCRRIPETSCNAYGTYSTY
SNGTCQCKDSVIGEQCDTCKPSSFHLNSFTYTGCIECFCSGVATDCDSSTWYRDQVTSTF
GRSLADHGFALVTNYMEFIPSTIPVSISTDLKELRFVGSASHAGNTLYWSLPAAFLGNKL
SAYGGKLTYTLSYSPPPNGIMSRNSAPDVVIKSGEDVRLIHYRKSQFVPGVANTYSVEIK
ESAWQRDDEVVANREHVLMALSDIKAIYIKATYTTSTKEVALRQVSLDVATPTNLGTARA
VEVEQCRCPEGYLGLSCEQCAPGYAREPEAGIYLGICKPCECNGHSKYCNSDTGDCEECS
DNTEGPSCERCAPGYVGDATRGTIYDCQPDDSGPPPYDNQTFKCTSYCSTEGTYECRGNE
CQCKRNVIGDRCDQCRPGTYGLSAQNQDGCKECYCSGLASQCRSAPLYRQLIPVDFILNA
PLITDENGVVQDTENLIPDISRNMFTYEYISYLPKYWSLRGSVLGNQLYSYGGRLSYSLI
VQSYGNYERGHDVVLIGNGLKLIWSRPEGTEDQEEYNVRLHEDEQWTRQDRESAQPASRS
DFMTVLSDLQHILIRATPKVPTQSTSIGNVILESAVTTRMPGATHASDIELCQCPTGYTG
TSCESCAPLYYRDASGSCSLCPCEASNTEFCDLVSGGYVECRCKARWKGDRCREIDTNDP
THTGTADPVLSQIIVSIQKPEITIVPVGGSMTLSCSGRMRWNNSPVIVNWYKENSRLPEN
VEVQGGNLYLYDLQISDSGIYICQAVNNETARVYTDSVSITISKKDQLSPAEIVNLPSHV
TFEEYVTNEIVCEVRGNPAPRVTWARVDGHADAQSTRTYDNRLIFDSPRKSDEGRYRCQA
ENEQNRDEQYVIVYVESNAPQPPPPQDRLYITPEEINTLAGDSFQLNCQFTSVASLRYDW
THEGRSLSSSPARNVQIRGNVLEVRDASERDSGIYTCIAYDVRTRRNFTEIARVNIEQRE
ELPLGNKPIIESLEQNILIIQGEDYSITCKASGSPYPSIKWAKVHDLMPENVHISGNVLT
IYGARFDNRGVYSCVAENVHGSDLSSTSIDIEPRERPSVKIASAPLQTFSVSAQASLYCT
VEGIPDPTIEWVRVDGQPLSPRHKIQAPGYMVIDDIQIEDSGDYECRARNIVGEASGVAT
INVQEPTNVHLMPNNRDIKLTEGDELSVTCVGSGVPNPEVYWLYESGSNRNALKVNRPSN
TAVLNIYRVSLKDAGIYTCRGSNEAGTDEVHIRVDVHARRGDIGEVDDDTDLEPVHYDPE
PPRLPGIDQPSNQLLPTDFGENVTLTCDIYQNVNTKWERVDGSPLPHNAYAFKNRLEIVH
IEQQNLGQYRCIGIGRDGKPESYVVRELVLLPLPRIRFYPNIPLTVDAGQNLDVHCQVEN
VRPEDVYWSTDNNRPLPSSVRIEGSVLRFVSITPAAAGEYRCSAFNKYGNRSEIARVVVK
KPTGFQLVPQSQVQQQREGESIKLQCSLTTQYGGNVQFKWYRYDGSVLPNNARPDSQVLV
LSNLRPEDAGRYICDSYDVDRRQQLSEVSIDLQVLTATPPPNSPIYLPPPQLPGKSRDYS
LKLDEQSSNLRAGDSTNVECYSYDDTYTDVVWERSDGTPLSNNVRQVGNRLVISNVAPSD
AGSYVCKCKTDEGDLYTTSYKLEVEDQPHELKSSKIVYAKVGGNADLQCGADEGRRPTYR
WSRQYGQLQAGRDLLNEKLSLNSVQANDAGTYICTAAYGDGETVDFPNILVVTGAIPQFR
QEPRSYMSFPTLPNSSFKFNFELTFRPENSDGLLLFNGQTRGSGDYIALSLKDRYAEFRF
DFGGKPMLVRAEEPLALNEWHTVRVSRFKRDGYIQVDEQHPVAFPTLQQIPQLDLIEDLY
IGGVPNWELLPADAVSQQVGFVGCISRLTLQGRTVELIREAKYKEGITDCRPCSQGPCQN
KGVCLESQTEQAYTCICQPGWTGRDCAIEGTQCTPGVCGAGRCENTDNDMECLCPLNRSG
DRCQYNEILNEQSLNFKDNSFAAYGTPKVTKVNITLFVRPSSLEDSVILYTAESTLPSGD
YLALVLRGGHAELLINTAARLDPVVVRSAEPLPLNRWTRIEIRRRLGEGILRVGDGPERK
AKAPGSDRILSLKTHLYVGGYDRSTVKVNRDVNITKGFDGCISRLYNFQKPVNLLADIKD
AANIQSCGETNMIEGDEDTDNEPPVPPPTPDVHENELQPYAMAPCASDPCENGGSCSEQQ
GMAVCSCPFGFSGKQCQEHLQLGFNASFRGDGYVELNRSYFQPALEQSYTSMGIVFTTNK
PNGLLFWWGQEAGEEYTGQDFIAAAVVDGYVEYSMRLDGEEAVIRNSDIRVDNGERHIVI
AKRDENTAILEVDRMLHSGETRPTSKKAMKLPGNVFVGGAADIEVFTGFRYKHNLNGCIV
VVEGETVGQINLSSAAVNGVNANVCPADDDPLGGTEPPVV
Download sequence
Identical sequences FBpp0131156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]