SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0131729 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0131729
Domain Number 1 Region: 1160-1431
Classification Level Classification E-value
Superfamily YWTD domain 4.71e-21
Family YWTD domain 0.016
Further Details:      
 
Domain Number 2 Region: 862-952
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000051
Family Pre-dockerin domain 0.047
Further Details:      
 
Weak hits

Sequence:  FBpp0131729
Domain Number - Region: 612-636
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000478
Family EGF-type module 0.069
Further Details:      
 
Domain Number - Region: 581-604
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00111
Family EGF-type module 0.042
Further Details:      
 
Domain Number - Region: 545-571
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00191
Family Integrin beta EGF-like domains 0.056
Further Details:      
 
Domain Number - Region: 711-737
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00837
Family Integrin beta EGF-like domains 0.077
Further Details:      
 
Domain Number - Region: 516-540
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0109
Family EGF-type module 0.098
Further Details:      
 
Domain Number - Region: 1342-1566
Classification Level Classification E-value
Superfamily Nitrous oxide reductase, N-terminal domain 0.0314
Family Nitrous oxide reductase, N-terminal domain 0.029
Further Details:      
 
Domain Number - Region: 681-706
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0455
Family Integrin beta EGF-like domains 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0131729   Gene: FBgn0105455   Transcript: FBtr0133237
Sequence length 2729
Comment type=protein; loc=scaffold_4784:complement(21959636..21961927,21962132..21965459,21967005..21967212,21967273..21967818,21967909..21968320,21968458..21968741,21971759..21972409,22003931..22004110,22070277..22070565); ID=FBpp0131729; name=Dere\GG13183-PA; parent=FBgn0105455,FBtr0133237; dbxref=FlyBase:FBpp0131729,FlyBase_Annotation_IDs:GG13183-PA,GB_protein:EDV52756,REFSEQ:XP_001973730,FlyMine:FBpp0131729; MD5=f45393696d4c19c67eb23ddaa65e4bdf; length=2729; release=r1.3; species=Dere;
Sequence
MNPYEYESTLDCRDAGGGPAPAHAHPHAQGRTLPMSGHGRPATDLGPVHGSQTLQHQNQQ
NLQAAQSSHYDYEYQHLAHRPPDTANNTAQRTHGRQGFLLEGVTPTAPPDVPPRNPTMSR
MQNGRLTVNNPNDVDFEPSCLVRTPSGNVYIPSGNLNINKGSPIDFKSGSACSTPTKDTL
KGYERSTQGCMGPVLPPRSVMNGLPAHHYSAPMNFRKDLVARCSSPWFGIGSISVLLAFV
VMLILLTTTGVIKWNQSPPCSVLVGNEASEVTAAKSTNTDLSKLHNSSVRAKNGQGIGLA
QGQAGLGAAGVGSAGGGGSSAATVTTTTSNSGTAQGLQSTSASAEATSSAATSSSQSSLT
PSLSSSLANANNGGARTFPARSFPPDGTTFGQITLGQKLTKEIQPYSYWNMQFYQSEPAY
VKFDYTIPRGASIGVYGRRNALPTHTQYHFKEVLSGFSASTRTARAAHLSITREVTRYME
PGHWFVSLYNDDGDVQELTFYAAVAEDMTQNCPNGCSGNGQCLLGHCQCNPGFGGDDCSE
SVCPVLCSQHGEYTNGECICNPGWKGKECSLRHDECEVADCSGHGHCVSGKCQCMRGYKG
KFCEEVDCPHPNCSGHGFCADGTCICKKGWKGPDCATMDQDALQCLPDCSGHGTFDLDTQ
TCTCEAKWSGDDCSKELCDLDCGQHGRCEGDACACDPEWGGEYCNTRLCDVRCNEHGQCK
NGTCLCVTGWNGKHCTIEGCPNSCAGHGQCRVSGEGQWECRCYEGWDGPDCGIALELNCG
DSKDNDKDGLVDCEDPECCASHVCKTSQLCVSAPKPIDVLLRKQPPAITASFFERMKFLI
DESSLQNYAKLETFNESRSAVIRGRVVTSLGMGLVGVRVSTTTLLEGFTLTRDDGWFDLM
VNGGGAVTLQFGRAPFRPQSRIVQVPWNEVVIIDLVVMSMSEEKGLAVTTTHTCFAHDYD
LMKPVVLASWKHGFQGACPDRSAILAESQVIQESLQIPGTGLNLVYHSSRAAGYLSTIKL
QLTPDVIPASLHLIHLRITIEGILFERIFEADPGIKFTYAWNRLNIYRQRVYGVTTAVVK
VGYQYTDCTDIVWDIQTTKLSGHDMSISEVGGWNLDIHHRYNFHEGILQKGDGSNIYLRN
KPRIILTTMGDGHQRPLECPDCDGLATKQRLLAPVALAAAPDGSLFVGDFNYIRRIMTDG
SIRTVVKLNATRVSYRYHMALSPLDGTLYVSDPESHQIIRVRDTSDYSQPELNWEAFVGS
GERCLPGDEAHCGDGALAKDAKLAYPKGIAISSDNIMYFADGTNIRMVDRDGIVSTLIGN
HMHKSHWKPIPCEGTLKLEEMHLRWPTELAVSPMDNTLHIIDDHMILRMTPDGRVRVISG
RPLHCATASTAYDTDLATHATLVMPQSIAFGPLGELYVAESDSQRINRVRVIGTDGRIAP
FAGAESKCNCLERGCDCFEAEHYLATSAKFNTIAALAVTPDSHVHIADQANYRIRSVMSS
IPEASPSREYEIYAPDMQEIYIFNRFGQHVSTRNILTGETTYVFTYNVNTSNGKLSTVTD
AAGNKVFLLRDYTSQVNSIENTKGQKCRLRMTRMKMLHELSTPDNYNVTYEYHGPTGLLR
TKLDSTGRSYVYNYDEFGRLTSAVTPTGRVIELSFDLSVKGAQVKVSENAQKEMSLLIQG
ATVIVRNGAAESRTTVDMDGSTTSITPWGHNLQMEVAPYTILAEQSPLLGESYPVPAKQR
TEIAGDLANRFEWRYFVRRQQPLQAGKQSKGPPRPVTEVGRKLRVNGDNVLTLEYDRETQ
SVVVMVDDKQELLNVTYDRTSRPISFRPQSGDYADVDLEYDRFGRLVSWKWGVLQEAYSF
DRNGRLNEIKYGDGSTMVYAFKDMFGSLPLKVTTPRRSDYLLQYDDAGALQSLTTPRGHI
HAFSLQTSLGFFKYQYYSPINRHPFEILYNDEGQVLAKIHPHQSGKVAFVHDTAGRLETI
LAGLSSTHYTYQDTTSLVKSVEVQEPGFELRREFKYHAGILKDEKLRFGSKNSLASAHYK
YAYDGNARLSGIEMAIDDKELPTTRYKYSQNLGQLEVVQDLKITRNAFNRTVIQDSAKQF
FAIVDYDQHGRVKSVLMNVKNIDVFRLELDYDLRNRIKSQKTTFGRSTAFDKINYNADGH
VVEVLGTNNWKYLFDENGNTVGVVDQGEKFNLGYDIGDRVIKVGDVEFNNYDARGFVVKR
GEQKYRYNNRGQLIHSFERERFQSWYYYDDRSRLVAWHDNKGNTTQYYYANPRTPHLVTH
VHFPKLSRTMKLFYDDRDMLIALEYEEQRYYVATDQNGSPLAFFDQNGSIVKEMKRTPFG
RVIKDTKPEFFVPIDFHGGLIDPHTKLVYTEQRQYDPHVGQWMTPLWETLATEMSHPTDV
FIYRYHNNDPINPNKPQNYMIDLDSWLQLFGYDLNNMQSSRYTKLAQYTPQASIKSNTLA
PDFGVISGLECIVEKTSEKFSDFDFVPKPLLKMEPKMRNLLPRVSYRRGVFGEGVLLSRI
GGRALVSVVDGSNSVVQDVVSSVFNNSYFLDLHFSIHDQDVFYFVKDNVLKLRDDNEELR
RLGGMFNISTHEISDHGGSAAKELRLHGPDAVVIIKYGVDPEQERHRILKHAHKRAVERA
WELEKQLVAAGFQGRGDWTEEEKEELVQHGDVDGWNGIDIHSIHKYPQLADDPGNVAFQR
DAKRKRRKTGSSHRSASNRRQLKFGELSA
Download sequence
Identical sequences B3NJ39
XP_001973730.1.56816 FBpp0131729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]