SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0132430 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0132430
Domain Number 1 Region: 623-739
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.85e-28
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 2 Region: 503-619
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.2e-24
Family Spermadhesin, CUB domain 0.002
Further Details:      
 
Domain Number 3 Region: 744-856
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000000222
Family Spermadhesin, CUB domain 0.0025
Further Details:      
 
Domain Number 4 Region: 155-197
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000331
Family EGF-type module 0.0076
Further Details:      
 
Domain Number 5 Region: 857-921
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000288
Family Spermadhesin, CUB domain 0.004
Further Details:      
 
Domain Number 6 Region: 461-504
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000059
Family EGF-type module 0.016
Further Details:      
 
Domain Number 7 Region: 192-234
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000639
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 8 Region: 290-336
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000754
Family EGF-type module 0.024
Further Details:      
 
Domain Number 9 Region: 425-459
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000104
Family EGF-type module 0.017
Further Details:      
 
Domain Number 10 Region: 322-374
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000955
Family EGF-type module 0.016
Further Details:      
 
Weak hits

Sequence:  FBpp0132430
Domain Number - Region: 247-273
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00657
Family EGF-type module 0.072
Further Details:      
 
Domain Number - Region: 371-411
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0383
Family EGF-type module 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0132430   Gene: FBgn0106147   Transcript: FBtr0133938
Sequence length 939
Comment type=protein; loc=scaffold_4784:complement(11782468..11782721,11782811..11784714,11784778..11784884,11785333..11785887); ID=FBpp0132430; name=Dere\GG13884-PA; parent=FBgn0106147,FBtr0133938; dbxref=FlyBase:FBpp0132430,FlyBase_Annotation_IDs:GG13884-PA,GB_protein:EDV51469,REFSEQ:XP_001972443,FlyMine:FBpp0132430; MD5=f07bd859dfad06736bf10063a612d3e4; length=939; release=r1.3; species=Dere;
Sequence
MLIRSLKCTFLLVLCLQFHPSNSAGDNLEQRAHLVRQWNDNLLLEPAWDRNVTLRLMGES
ATVTINDVDIMSMLRRRQRIITDRQAAQREPILVETVKDMFQDVERKMTRLQRRVFNARN
NTGRSGLNQRLLRRHLQRVERVRGILWTLAGNLARNECVSNPCKNGGTCHDAYKGFQCEC
PAAWEGSTCEDDVNECFTLSGTDLDGCLNNGQCINTPGSYRCVCRNGFTGTNCRLRHNTC
LLGGSRELCGEHGTCIQAGNSAGYVCICDQGWTWADANATSASPSACVRDVDECEPHVNP
CHAECINLPGSFRCGPCPAGYTGDGRFCRDIDECAGEDNGGCSLQPRVICTNTEGSHRCG
RCPPGWTGDGRTCTASDSNSCNNEGICHPLAKCEYVSDMVVCTCPLGSFGHGYGADGCTA
DPSRLPCDQHTCQNNGTCVQSGRGTTCICQPGYSGAVCSSSDVCHPSPCLNGGTCRLLPD
AKYQCVCPRSYTGTICSHQRFFCGSTIHGPSGQLHYPPNTSDGDYQADERCPFIIRTNRN
LVLNLTFTQFQLEDSADCTADFLQLHDGNALTSRLIGRFCGSRLPMTNGTVITTQEQAFF
WFRSNNETQGKGFHVIWNSLPFSCGETINLTSTQSGVLRSPGYPGHARPELDCRWQLTAP
FGYRVLLRFYDISLGSSEASAGNCSEDSLIVYDSDRQLLRACQSLQPAPLYSSSNSLRLD
FHTDDIGSDSSFQMHYEVVPGQPGCGGVFTESRGHISGYMDFEVCLYLIEQPRGTQVKLV
IDRPNLVETLGCSLLNIEIFDGRTTDSPLIRRICGSPEESELEPIISTGNVILVRHEYAL
SGVGLGKSFDLTYTRVCTGSFDTYSGEISTPNYPGPYPDDITCIYNFTGPLDTAVEFRIT
DLSLGTADNENDTFYLDVSDICHPKTIFSRLNLAGVFSG
Download sequence
Identical sequences FBpp0132430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]