SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0132615 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0132615
Domain Number 1 Region: 2877-3048
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.94e-32
Family Laminin G-like module 0.001
Further Details:      
 
Domain Number 2 Region: 2672-2856
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.01e-29
Family Laminin G-like module 0.0037
Further Details:      
 
Domain Number 3 Region: 3357-3525
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.85e-28
Family Laminin G-like module 0.0043
Further Details:      
 
Domain Number 4 Region: 3064-3225
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.45e-26
Family Laminin G-like module 0.0036
Further Details:      
 
Domain Number 5 Region: 3536-3724
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.7e-24
Family Laminin G-like module 0.0021
Further Details:      
 
Domain Number 6 Region: 1917-1971
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000109
Family Laminin-type module 0.0025
Further Details:      
 
Domain Number 7 Region: 541-589
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000114
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 8 Region: 1466-1516
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000232
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 9 Region: 1867-1919
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000254
Family EGF-type module 0.077
Further Details:      
 
Domain Number 10 Region: 1809-1861
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000106
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 11 Region: 495-543
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000112
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 12 Region: 632-679
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000307
Family Laminin-type module 0.0062
Further Details:      
 
Domain Number 13 Region: 1375-1423
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000363
Family Laminin-type module 0.0062
Further Details:      
 
Domain Number 14 Region: 732-782
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000053
Family Laminin-type module 0.0079
Further Details:      
 
Domain Number 15 Region: 1970-2019
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000725
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 16 Region: 1514-1562
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000781
Family Laminin-type module 0.0044
Further Details:      
 
Domain Number 17 Region: 333-390
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000226
Family Laminin-type module 0.057
Further Details:      
 
Domain Number 18 Region: 273-330
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000331
Family Laminin-type module 0.041
Further Details:      
 
Domain Number 19 Region: 1427-1463
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000391
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 20 Region: 448-497
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000014
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 21 Region: 2017-2066
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000017
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 22 Region: 677-729
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000307
Family Laminin-type module 0.0065
Further Details:      
 
Domain Number 23 Region: 403-450
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000307
Family Laminin-type module 0.042
Further Details:      
 
Domain Number 24 Region: 785-823
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000469
Family Laminin-type module 0.028
Further Details:      
 
Weak hits

Sequence:  FBpp0132615
Domain Number - Region: 587-634
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000109
Family Laminin-type module 0.034
Further Details:      
 
Domain Number - Region: 1774-1811
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000142
Family Laminin-type module 0.055
Further Details:      
 
Domain Number - Region: 2064-2112
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000753
Family Laminin-type module 0.016
Further Details:      
 
Domain Number - Region: 135-230
Classification Level Classification E-value
Superfamily Sialidases 0.0167
Family Sialidases (neuraminidases) 0.078
Further Details:      
 
Domain Number - Region: 2105-2216
Classification Level Classification E-value
Superfamily Cytochrome c 0.0439
Family Di-heme cytochrome c peroxidase 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0132615   Gene: FBgn0106331   Transcript: FBtr0134123
Sequence length 3725
Comment type=protein; loc=scaffold_4784:complement(8894117..8895609,8895674..8895888,8895951..8899142,8899221..8901592,8901649..8901877,8901939..8902219,8902282..8902933,8902989..8903841,8903907..8904179,8904246..8904659,8904733..8904942,8905037..8905661,8907092..8907238,8907590..8907811); ID=FBpp0132615; name=Dere\GG14069-PA; parent=FBgn0106331,FBtr0134123; dbxref=FlyBase:FBpp0132615,FlyBase_Annotation_IDs:GG14069-PA,GB_protein:EDV51129,REFSEQ:XP_001972103,FlyMine:FBpp0132615; MD5=915e3e95e704ec2638ff894d32f3ab80; length=3725; release=r1.3; species=Dere;
Sequence
MGHGVASIGALLVILGTSYSQAELTPPYFNLATGRKIYATATCGQDTDGPELYCKLVGAN
TEHDHIDYSVIQGQVCDYCDPSVPERNHPPENAIDGTEAWWQSPPLSRGMKFNEVNLTIN
FEQEFHVAYLFIRMGNSPRPGLWTLEKSTDYGKTWTPWQHFSDTPADCETYFGKDTYKPI
TRDDDVICTTEYSKIVPLENGEIPVMLLNERPSSTNYFNSTVLQEWTRATNVRIRLLRTK
NLLGHLMSVARQDPTVTRRYFYSIKDISIGGRCMCNGHADTCDVKDPKSPIRILACRCQH
HTCGIQCNECCPGFEQKKWRQNTNARPFNCEPCNCHGHSTECKYDEEVNRKGLSLDIHGH
YDGGGVCQNCQHNTVGTNCNKCKPKYYRPKGKHWNETDVCSPCQCDYFFSTGHCEEETGN
CECRAAFQPPSCDSCAYGYYGYPNCRECECNLNGTNGYHCEAESGQQCPCKINFAGAYCK
QCAEGYYGFPECKACECNKIGSITNDCNVTTGECKCLTNFGGDNCERCKHGYFNYPTCSY
CDCDNQGTESEICNKQSGQCICREGFGGPRCDQCLPGFYNYPDCKPCNCSSTGSSAITCD
NTGKCNCLNNFAGKQCTLCTAGYYSYPDCLPCHCDTYGSQGVSCNADGQCLCQPNFDGRQ
CDSCKEGFYNFPSCEDCNCDPAGVIDKFAGCGSVPVGELCKCKERVTGRICNECKPLYWN
LNISNTEGCEICDCWTDGTISALDTCTSKSGQCPCKPHTQGRRCQECRDGTFDLDSASLF
GCKDCSCDVGGSWQSVCDKISGQCKCHPRITGLACTQPLTTHFFPTLHQFQYEYEDGSLP
SGTQVRYDYDEAAFPGFSSKGYVVFNAIQNDVRNEVNVFKSSLYRIVLRYVNPNAENITA
TISVTSDNPLEVDQHVKVLLQPTSEPQFVTVAGPLGVKPSAIVLDPGRYVFTTKANKNVM
LDYFVLLPAAYYEAGILTRHISNPCELGNMELCRHYKYASVEVFSPAVTPFVIGENSKPT
NPVEVYIDPEHLQIVSHVGDIPVLSKSQNELHYIVDVPRSGRYIFVIDYISDRNFPDSYY
INLKLKDNPDSETSVLLYPCLYSTICRTSVNEDGMEKSFYINKEDLQPVIISADIDDGSR
FPIISVTAIPVEQWSIDYINPSPVCVIHDQQCATPKFRSVPDSKKIEFETDHEDRIATNK
PPYAALDERVKLVHLDSLNEATIVIESKVDATKPNLFVILVKYYQPSHPKYQVYYTLTAG
KNQYDGKFDIQHCPSSSGCRGVIRPAGEGSFEIDDEFKFTITTDRSQSVWLDYLVVVPLK
QYNDDLLVEETFDQTKEFIQNCGHDHFHITHNASDFCKKSVFSLTADYNSGALPCNCDYA
GSTSFECHPFGGQCQCKPNVIERTCGACRSRYYGFPDCKPCKCPNSAMCEPSTGECMCPP
NVIGDLCEKCAPNTYGFHQVIGCEECACNPMGIANGNSQCDLFNGTCTCRENIEGRACDV
CSNGYFNFPHCEQCSCHKPGTELEVCDKVDGECFCKKNVVGRDCDQCDDGTYNLQESNPE
GCTTCFCFGKSSRCDSAYLRVYNVSLLKHVSITTPEFRDESIKFEMWPVPVEEILLNETT
LKADFTSREVSDERPAYFGVLDYLLNQNNHITAYGGDLAYTLHFSSGFDGKYIVAPDVIL
FSEHNVLEHTSYEQPNRNEPFTNRVSIVESNFQTVSGKPVSRADFMMVLRDLKMIFIRAN
YWEQTLVTHLSDVYLTLADEDEDGTGKYELLAVERCSCPPGYSGHSCEDCAPGYYRDPSG
PYGGYCIPCECNGHSETCDCATGICSNCQHGTQGEHCEQCVSGYYGNATNGTPGDCMICA
CPLPFDSNNFATSCEISESGDQIHCECKPGYTGPRCESCANGFYGQPENMGEVCKPCECS
GNINPEDQGSCDTRTGECLRCLNNTSGAACNLCAPGFYGDAIKLKNCQSCDCDDLGTLEC
DPFVGVCTCHENVIGERCDRCKPDHYGFESGVGCRACDCGAASNSTQCDPHTGHCACKSG
VTGRQCDRCAVDHWKYEKDGCTPCNCNQGYSRGFGCNPNTGKCQCLPGVIGDRCDACPNR
WVLLKDDGCQECNNCHHALLDVTDRMRYQIDGVLEDFNSVTLAFFTSQKLNYYDQLADEL
EPNVKHLDRNSVDLNPSQKANSELESDAKSFAKQVNQTQALALDIRERSSTTLGNITVAY
DEAVKSAIQAKEAIASVKALSKNLQAAASTKIDAALEEAQHILGQISGTSIELTPNEKVL
EKARILYEDVNTLVLPIKEQNKSLNALKNDIGEFSDHLEDLFNWSTDSQAKSADVERRNV
ANQKAFDNSKFDTVSEQKQQAEKNINDAGNFLINGDLTLSQINQKLDNLRDALTELNTVN
KNVDEELPAREDQHKEADALTDQAEQKAAELAIKAQDLAAQYTDMTASAEPAIKAATAYS
GIVEAVEAAQKLSQDAIAAAGNATAMTNGIDDRAHIADTDSTNLLQKARQSLQKVQDDLQ
PRLNASAGKVQKISDVNNATEHQLKDIKMLIDQLPAESQRDMWKNSNANASDALEILKNV
LEILEPVSVQTPKELEKAHGINRDLDLTNKDVSQANKQLDDVEGSVSKLNELAEDIEEQQ
HRVGTQTLQLGQEIENLKTKVEAARQLANSIKVGVNFKPSTILELKTPEKTKLLATRTNL
STYFRTTEPSGFLLYLGNDNKTAQKNNDFVAVEIVNGYPILTIDLGNGPERITSDKYVAD
GQWYQAVVDRMGPNVKLTIREELKNGDVDEHSNSGYLEGSQNILHVDKNSRLFVGGYPGI
SDFNAPADLTTNSFSGDIEDLKIGDESVGLWNFVYGDDNDQGALERDVLLEKKKRVTGLR
FKGNGYVQLNATSNFKSRSSIQFSFKADKDTSNGLLFFYGKDKHYMSIEMIDGAIFFNIS
LGEGGGVQSGSQDRYNDNKWHKVQAERENRNGLLKVDDIVISRTNAPLQADLELPKLRKL
YFGGHPRRLNTTISFQPNFDGCIDNVVINQGIVDLTEYVTGGGVEEGCSAKFSTVVSYAP
HEYGFLRMGNVSTNNNLHVVLHFKTNQPNGVLFYAANHDQSSTIGLSLQDGLLKLNSMGS
QLVIDDHILNDGEDHGVTVQHTQGELRLSVDDVYNKRLGSPQPLILEGGDIFFAGLPDNY
RTPRNALASLAYFVGCISDVNVNEEIINFANSAEKKNGNINGCPPHVLAYEPSLVPSYYP
SGDNEVESPWSNADTLPPLKPDIETTLPTTLPTTLPTTTPTTTTTTTTTTTTTTSTTTTT
PSTTTIRTTTSPIAFDEDKENEAKAPQRTLTTRAPAKLHLPSDERCKLPEQPNFDVDFAE
AGYRFYGLREQRLQINSLPVKVRRHHDIGISFRTERPNGLLIYAGSKQRDDFIAVYLLDG
RVTYEIRVGAQLQAKITSEADLNDGNWHTVEVLRTQRKVTLLIDKLEQPGSVDLNAERSA
PVLAVELPIYLGGVNKFLEAEVKNLTDFKTEVPFFNGCLKNIKFDAMDLETPPEQFGVVP
CSEQVERGLFFNNQKAFVKIFDHFDVGTEMKISFDFRPRDPNGLLFSVHGKNSYAILELV
DNTLYFTVKTDLKNIVSTNYKLPNNESFCDGKTRNVQAIKSKFVINIAVDFISSNPGVGN
EGSVITRTNRPLFFGGHVAFQRAPGIKTKKSFKGCISRVEVNQRMINITPNMVVGDIWQG
YCPLN
Download sequence
Identical sequences B3NGG3
XP_001972103.1.56816 FBpp0132615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]