SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0132652 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0132652
Domain Number 1 Region: 460-550
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000229
Family I set domains 0.015
Further Details:      
 
Domain Number 2 Region: 565-603
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000318
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0132652   Gene: FBgn0106368   Transcript: FBtr0134160
Sequence length 624
Comment type=protein; loc=scaffold_4784:complement(8500877..8500928,8502683..8502736,8503558..8503666,8503904..8504031,8504100..8504277,8528216..8529569); ID=FBpp0132652; name=Dere\GG14106-PA; parent=FBgn0106368,FBtr0134160; dbxref=FlyBase:FBpp0132652,FlyBase_Annotation_IDs:GG14106-PA,GB_protein:EDV51057,REFSEQ:XP_001972031,FlyMine:FBpp0132652; MD5=d4d203a9fdcfd56b62448ba243c67ff8; length=624; release=r1.3; species=Dere;
Sequence
MYAQHLRKWSLKTKKQLMPLILLIISYMLLLNTCVLSSAATTQQLLLQQQQQQQLPRLWE
GSAEESSYYIPLSSDNGSGSSESAESGSSSSSSSSSNIDNNILSRLLSLNSNSLSSRSNV
KLKPATVFDAGSSSPAQQEQHVAAEPEQQQQQQQSMQKVPNTLINSQIYNLLYNGMPSEA
ASSKMRRHIQPTQLPHQPESLARLPSNYSSQAAVRSYLIESYEMPGSQAEDRSPEQAARS
RRDGSNTNGSRQKHRPGHRKQLQQDRRDHRRQRLDQQKERRQQQQHQHKSSNKHHNHQQP
QQRRKHQRTHRGGHQRSGRYCSARDPEQLAYAAPTVFQGVFKSMSADRRVNFSATMKVER
VYKQQHDLQLPTLVRLQFALSNSSGECDIYRERLLPRGMLRSGNDLQQASDISYMMFVQQ
TNPGNFTILGQPMRVTKAVMRAVQMAVSENYAQNASIEKIKSEPNNTTIEDGQELRIICK
VSGQPLPKVTWFKDDKSINRKRNIYQFKHHKRRSELIVRSFNSSSDAGKYECRAKNKASK
AIVKRRIMIKASEVHSPPDGSGLGTPCNFDYCFHNGTCRIIADINEVYCRCPTEYFGKRC
ENKRPDSRYFVAIYGQIHTLNNDY
Download sequence
Identical sequences FBpp0132652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]