SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0132985 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0132985
Domain Number 1 Region: 969-1024
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000067
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 2 Region: 813-944
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000267
Family Growth factor receptor domain 0.0067
Further Details:      
 
Domain Number 3 Region: 769-817
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000287
Family EGF-type module 0.0053
Further Details:      
 
Domain Number 4 Region: 320-369
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000041
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 5 Region: 618-743
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000235
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 6 Region: 1138-1203
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000181
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 7 Region: 375-388,425-543
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000345
Family Growth factor receptor domain 0.0085
Further Details:      
 
Domain Number 8 Region: 504-621
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000022
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 9 Region: 58-115
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000723
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 10 Region: 1210-1265
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000917
Family Complement control module/SCR domain 0.0051
Further Details:      
 
Weak hits

Sequence:  FBpp0132985
Domain Number - Region: 278-328
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000233
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0132985   Gene: FBgn0106698   Transcript: FBtr0134493
Sequence length 1533
Comment type=protein; loc=scaffold_4784:complement(3775582..3775695,3775750..3775880,3775955..3776057,3776112..3776352,3776446..3776476,3776855..3777238,3777301..3779811,3779878..3780000,3780063..3780971,3781978..3782032); ID=FBpp0132985; name=Dere\GG14439-PA; parent=FBgn0106698,FBtr0134493; dbxref=FlyBase:FBpp0132985,FlyBase_Annotation_IDs:GG14439-PA,GB_protein:EDV50450,REFSEQ:XP_001971424,FlyMine:FBpp0132985; MD5=8128eeef267de75ea61bb7f562956f34; length=1533; release=r1.3; species=Dere;
Sequence
MWAAKYVLCALACVAFASASPSSGRKRKNVMDIPEDPLVPVSVAATLDMSCSAAKILPPE
ISHGRVSLFDRRRRGKKVFLVAFFVCDDNYEFESGNSEMFCSNQKWVGEIPTCIPQHDYV
EPDEKMESYEDYNAYDSDIEESGIDEEEDPEDSEWEPPSPTPLLDSKSRPEMENDNEENK
IVPNDDEDEKPGDSERKPPPPPPPPVVDGAESRPEPDIVIDIGDGPANEIVEPELPKNLA
ENETPLEPEVHTDVLNSGNASVETTKDPYEPTLLDNNCGEDNGGCEQICKRLLYPDENQP
VNKCDCREGYTLDPTDYASCLDIDECLESNGGCSEICENLPGEYKCSCQEGYYLDDSGMN
CADIDECANSELSSDCHGGCENLPGSYRCVEPLVEKPDTTEVVENPIEEGNEIPEKSSEV
QPAGKSCNSGFQLSADGTDCQDINECEVEGPEDLDNNAVCQQKCENTIGSFRCSCAEGYH
LLEDQRSCAWDTCADLEKPQLNRTRCAHECQDLPEGSYRCVCPKGYELSENQHSCLVQES
PCTTEKGAEKCSPGTCLASEDNASFSCICPTGYRSGVSSCQDIDECAEDMHLCSHTCQNT
PGGYQCQCPEGLNLVEEYTCLAENLCEVNNNGCEQICLTARGGSCSCREGFRLSADGKSC
EDVDECLVNNGGCQQVCRNLQGSYGCICAAGYELLKLDGIRGYCFDIDECSQGTHGCSDQ
MLCENLNGSYTCLCPPGYALGLDNHIVTSLNTTFITDSTSSDAPSPPACLDIDECSLANG
NCSHFCQNEPGGFLCACPLGYALSEDMRTCQDIDECLDSNGQCSQLCLNQPGGFACACET
GFELTPDGFGCSDIDECSQDYGNCSDICINLLGTHACACERGYELAKDKQSCQDVDECAG
LLSGGCSHECINKAGTFECGCPLGYILNDDERSCRPALVGCPPGTQRSAEGCAPIECKPG
FILGSDDKCVDIDECQQKNGGCSHRCSNSEGSFKCSCPPGYKLDSDQKTCQDIDECAQDK
TSCVTGKCINEIGGFRCEFPRFPVLPDIPTASSLPESPKPEDKRPKYPDFNELSNEIPEQ
PKKPVFDFPETSFTSLPKWGDLPKLPPLDDITTTKAPVPQLPKVPKNTWVNQLQPRDLCP
RFQAPRNGKSHCNRYRHKQKLFYNSRCRISCNPGYVLEGPATKSCGANGIWEGPETKCVA
LNQPRVQSPGICPALKPAQNGAIFPASCTQGPSRFGDICQLQCNAGFMPTGSMLTACMVL
QGWSFGTDLNCQPFGYNRLGNSNGLFLKDNSLQWNSPETVMPHQIQKVQPNRPFIRCPEN
VVILLHADSETLPYLKQDFPDAGSSSHSSLEPFSSRSAKLISAVPAPGESTRVDLGSDTT
NYCPPSIEVYLKEHQNLRSVVWDEPRFEGKLLKIYKSHFPGSLFKVGDHAIKYEATTTDG
KTLSCTFFVYVRSAKPTPAPIEPKISFDSEPEIPSDGPETYVVCPDKEPVRVTTESVSLP
VGCTLKNVRPQSSSPKQLKRGKLTSLWHHYTNF
Download sequence
Identical sequences FBpp0132985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]