SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0133114 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0133114
Domain Number - Region: 97-131
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0012
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0133114   Gene: FBgn0106825   Transcript: FBtr0134622
Sequence length 136
Comment type=protein; loc=scaffold_4784:complement(1706657..1706799,1706864..1707027,1707086..1707189); ID=FBpp0133114; name=Dere\GG14568-PA; parent=FBgn0106825,FBtr0134622; dbxref=FlyBase:FBpp0133114,FlyBase_Annotation_IDs:GG14568-PA,GB_protein:EDV50214,REFSEQ:XP_001971188,FlyMine:FBpp0133114; MD5=8e258b1b105cac88e8639d76b61b2b0c; length=136; release=r1.3; species=Dere;
Sequence
MLRIILIAACLGQLVLAQADLKDLVGPNICKRREVYNVEVVYTELQSYQERGSTWCVTFP
PRCSTYRIKNRVVNKTNTIAKTRIVRDCCDGYIASAGECVPHCSEPCQHGRCISPEKCKC
DHGYGGPACDISSFTP
Download sequence
Identical sequences FBpp0133114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]