SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0133141 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0133141
Domain Number 1 Region: 36-271
Classification Level Classification E-value
Superfamily YWTD domain 3.53e-30
Family YWTD domain 0.00022
Further Details:      
 
Domain Number 2 Region: 401-434
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000738
Family EGF-type module 0.014
Further Details:      
 
Domain Number 3 Region: 436-483
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000469
Family EGF-type module 0.019
Further Details:      
 
Weak hits

Sequence:  FBpp0133141
Domain Number - Region: 366-400
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00221
Family EGF-type module 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0133141   Gene: FBgn0106851   Transcript: FBtr0134649
Sequence length 644
Comment type=protein; loc=scaffold_4784:complement(1487981..1488082,1488147..1488480,1488549..1489953,1493242..1493335); ID=FBpp0133141; name=Dere\GG14595-PA; parent=FBgn0106851,FBtr0134649; dbxref=FlyBase:FBpp0133141,FlyBase_Annotation_IDs:GG14595-PA,GB_protein:EDV50169,REFSEQ:XP_001971143,FlyMine:FBpp0133141; MD5=e58fc59214a4484d45fa036859ccbf16; length=644; release=r1.3; species=Dere;
Sequence
MIRIRFGMDVLLVLLLATCLLSPAHGTPLEWDFAVTLRTKIQFMDSSWQTIATAAHEFDE
LSAITFDESEELIYFNDMRHQNGSIFSLKRDLVAANHVVEQRIARTGNESVGGLAYDPLT
MNLFWSDIEQRKIFFAPIDGSAAPKVLVDLSAEGGRPDGVAVDVCRRKLYWTNSNVTHPT
VERINLDGNNRTVIINSTIDMPRGIVVDQLSDRLFWIDDLKGVFFAIESSKLDGSDRLVV
LKDKHHEPLNLAVTNDAIYWTDRTTRSVWSHPKVPVIRVTTTSKPVEEDSTDSTDFKDPE
PVNEDCPLVRVANLSEEVRGIVVRTGFYQRLQKDHHCASIVRKVKERVDAQNTKFEVRSL
QDQKMKILQDERCMNHGEYKPATDLCICPTGFKGSRCEIRECHNYCVHGTCQMSESAYPK
CYCQPGFTGERCEVSVCAGLCLNGGHCRASKDEKEAPSCECPAKFGGARCEQNSTEICTL
FCRLLKHEPEMYVPFGCHSICEELAQDNSTNIAVPQYQHLEVCLTPKVWTSSVIIILVIG
IVSSLLLVAVIVHGIRRLYKPKRPRIRKTFVVRKQARTNSAGDTPLTNRPLATEQCEITI
ENCCNMNICETPCFDPKLVEQTLSKSSCKEDKKILIHNMEDDLY
Download sequence
Identical sequences B3NBB6
XP_001971143.1.56816 FBpp0133141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]