SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0133938 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0133938
Domain Number 1 Region: 847-893
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000026
Family Laminin-type module 0.0005
Further Details:      
 
Domain Number 2 Region: 956-1006
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000335
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 3 Region: 744-795
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000201
Family Laminin-type module 0.0098
Further Details:      
 
Domain Number 4 Region: 299-361
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000204
Family EGF-type module 0.094
Further Details:      
 
Domain Number 5 Region: 461-511
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000698
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 6 Region: 902-953
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000363
Family Laminin-type module 0.0011
Further Details:      
 
Domain Number 7 Region: 414-461
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000279
Family Laminin-type module 0.0074
Further Details:      
 
Domain Number 8 Region: 799-849
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000837
Family Laminin-type module 0.007
Further Details:      
 
Domain Number 9 Region: 359-406
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000145
Family Laminin-type module 0.027
Further Details:      
 
Weak hits

Sequence:  FBpp0133938
Domain Number - Region: 1004-1050
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000198
Family Laminin-type module 0.024
Further Details:      
 
Domain Number - Region: 706-746
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000268
Family EGF-type module 0.093
Further Details:      
 
Domain Number - Region: 112-183
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00113
Family Galactose-binding domain 0.059
Further Details:      
 
Domain Number - Region: 1487-1618
Classification Level Classification E-value
Superfamily Tropomyosin 0.00333
Family Tropomyosin 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0133938   Gene: FBgn0084705   Transcript: FBtr0135446
Sequence length 1639
Comment type=protein; loc=scaffold_4784:join(9594405..9594599,9594922..9595055,9595118..9595245,9595312..9595926,9596461..9596872,9596943..9599528,9599586..9599922,9599980..9600280,9600348..9600559); ID=FBpp0133938; name=Dere\LanB2-PA; parent=FBgn0084705,FBtr0135446; dbxref=FlyBase:FBpp0133938,FlyBase_Annotation_IDs:GG15392-PA,GB_protein:EDV51226,REFSEQ:XP_001972200,FlyMine:FBpp0133938; MD5=52a061985cd579581f2e208a9d041598; length=1639; release=r1.3; species=Dere;
Sequence
MKHSRWSHSGSSTARLLLLGVLFASCSTAILGALRPPINSAGGHELRGTTFMPALECYDP
YGRPQKCLPEFINAAYQLQIESTNTCGEQNDNHFCIQTMNQNHKNCEFCKYNDHNPSFLT
DLHDPQSPTWWQSETMFEGIQHPNYVNLTLHLGKSYDITYVRILFRSPRPESFTIYKRTS
ESGPWIPYQFYSATCRDTYSLPDSRAIRKGEGEAHALCTSEYSDISPLRDGEIAFSTLEG
RPSGINFERSGELQEWVTATDIRISLDRLNTFGDELFGDSQVLQSYFYAISDIAVGARCK
CNGHASKCVPSTGMHGERTLVCECRHNTDGPDCDRCLPLYNDLKWKRSTSTEVNECKACN
CNGLADKCFFDASLFNRTGHGGHCLDCRENRDGPNCERCKENFYMRDDGYCVNCACDPVG
SRSLQCNSHGKCQCKPGVTGDKCDRCDNNYYQFGPHGCQQCGCDSGGSHENTPACDTDTG
ICFCKENVEGRRCNECKPGFFNLDKTNRFGCTPCFCYGHTSECMTAPGYSIVSVTSNFNK
FKERWTAADLNQREVDIKYNQYSRSIGTTAQGNEHVYFQAPDRFLGDQRASYNRDLKFKL
QLVGQVANTGVSDVILEGAGSRISLPIFAQGNGIPDQGVKEYTFRLHEHHDYQWQPSQSA
RGFLSILSNLTAIKIRATYSVQGEAILDDVELQTAHRGAAGHPATWIEQCTCPEGYLGQF
CESCAPGYRHSPARGGPFMPCIPCDCHGHADICDSETGRCICQHNTHGDNCDQCAKGFYG
NALGGTPSDCKRCPCPNDGACLQINEDTVICTECPKGYFGSRCEQCSDGFFGDPTGLLGD
AQTCKSCDCNGNVDPNAVGNCNRTTGECLKCIHNTAGEHCDQCLSGHFGDPLALPHGRCD
RCSCYAAGTEQDEQSITRCDQVTGQCQCKPNVIGRDCGECQPGYFNIRSGNGCENCLCDP
VGSYNSTCDRYSGQCHCRPGVMGQRCDQCENYFYGFSSEGCKPCECDESGSKGFQCDQNG
QCPCNDNVEGRRCDRCKENKYDRHRGCIDCPDCYNLVQEAADLHRAKLFNLSQTLDEIAR
TPVTNDDEFEAKLKAVQEKVALLAQDARDNSGEGGQTHAEVIDDLHKHLDSVREQLVSAD
KFQADANAEIDRARQNYTILDQITENAKKELQQALDLLNDEGAQALARAKEKSVEFGQQS
EQISDISREARALADKLESEAQFDLKNAKDAKDAVEKAHQLAKSAIDLQLKIGTELRSEV
GLELNHVKQLLGNGVQIAKEALRKANEVYETALTLLNDVNRQTQPEIDISQLKNDALAAN
ERADELLKQITDLSNSNGELFADFESEQELTEALLKRAEQQQLEDIELLERAKAAHDKAT
KAVEQGDNTLKEANNTYEKLAGFQSDVQRSSESAEKALQTVPNIEKEIQNAESLISQAEE
ALDGANKNANEAKKNAQEAQLKYAEQASKDAELIRRKANETKVAARNLRAEADQLNHRVK
LTEMDIFKLEESSTKDDNLVDDAKRKVGQAKADTQEAQKQIEKANEELTAIKDELENLKD
INTGDLDKLENRLATVEGEINRVNLTGRIEKYREQRTIQKNLIDKYDAELRELKDEVQNI
GLISKALPDSCFSRNRLEP
Download sequence
Identical sequences B3NCJ6
XP_001972200.1.56816 FBpp0133938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]