SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0134201 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0134201
Domain Number 1 Region: 2251-2404
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.33e-34
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00084
Further Details:      
 
Domain Number 2 Region: 2085-2224
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.08e-29
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0012
Further Details:      
 
Domain Number 3 Region: 1125-1185
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000262
Family ATI-like 0.043
Further Details:      
 
Domain Number 4 Region: 751-811
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000997
Family ATI-like 0.041
Further Details:      
 
Domain Number 5 Region: 2972-3032
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000654
Family ATI-like 0.05
Further Details:      
 
Domain Number 6 Region: 3639-3711
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000858
Family VWC domain 0.026
Further Details:      
 
Domain Number 7 Region: 1853-1913
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000173
Family Tachycitin 0.038
Further Details:      
 
Domain Number 8 Region: 1245-1296
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000154
Family BSTI 0.056
Further Details:      
 
Domain Number 9 Region: 194-240
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000193
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  FBpp0134201
Domain Number - Region: 290-335
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000502
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 3314-3391
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000572
Family BSTI 0.05
Further Details:      
 
Domain Number - Region: 789-851
Classification Level Classification E-value
Superfamily FnI-like domain 0.000764
Family Fibronectin type I module 0.066
Further Details:      
 
Domain Number - Region: 2521-2554
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00128
Family LDL receptor-like module 0.0026
Further Details:      
 
Domain Number - Region: 1934-2005
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0018
Family BSTI 0.062
Further Details:      
 
Domain Number - Region: 1296-1336
Classification Level Classification E-value
Superfamily FnI-like domain 0.00837
Family VWC domain 0.048
Further Details:      
 
Domain Number - Region: 2420-2462
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0556
Family ATI-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0134201   Gene: FBgn0107899   Transcript: FBtr0135709
Sequence length 3845
Comment type=protein; loc=scaffold_4784:join(13829833..13829936,13830572..13830667,13830747..13830911,13830974..13831363,13831423..13831550,13831606..13831701,13831766..13831963,13832066..13832229,13832289..13832446,13832508..13832662,13832722..13833324,13833427..13834545,13834630..13835523,13835578..13836126,13836183..13837505,13837569..13837647,13837710..13837959,13838013..13838760,13838821..13839318,13839379..13839885,13839950..13840433,13840505..13842282,13842340..13842552,13842614..13843069,13843126..13843382,13843437..13843562); ID=FBpp0134201; name=Dere\GG15655-PA; parent=FBgn0107899,FBtr0135709; dbxref=FlyBase:FBpp0134201,FlyBase_Annotation_IDs:GG15655-PA,GB_protein:EDV51701,REFSEQ:XP_001972675,FlyMine:FBpp0134201; MD5=df726085885996c18f4e09a44f28939f; length=3845; release=r1.3; species=Dere;
Sequence
MANKVFFAALWLLFISSVLTEDGDIIISDDDEDINPLLQAAPEVDDKENERNERHISFNI
HKAPAVSARYTYGGSAGVGGGYGAQRGYGGGFGGDGGYGGGLKTSHAAGGLIAKTLGFLG
MGQGNFYGNGGHMLAAFGKCSALQLPSNVQSECHNGRCKVSCPSGYSFAQDVSVLEMFCS
NDGWIIGNSVFTEVPPCQAQCTPRCQNNGICISAGVCQCPENYYGPVCQQKVSICASFPK
SPKNSKVSCKNNMCHAECMRGFQFPDGSEITNIECRNGQWVHTKTGLSKTPDCAPTCAPA
CQNGGQCISFNVCHCPKLFRGNQCQYNIDRCNVTNTNFNGNYKCAYEAEEARCTFSCTQV
PGLKIEGRIDIEYKCNYLTGQYLPAPLPKCIFPPGYTVRSTSSMQGVTHQNEVYNREMRD
GMAFELLTERQKLLALLAKYRDLERRSEWWSSEETVVTMSSYALYQSNNVDVVIDKNPRP
ALCTTWGGINMKTFDGLVFKAPLSCSHTLITDKVSGTFDIILKACPYGSGYGCAHTLKIL
WQSVQYTFENLNGTVQLTTPIKKLPMPVQVMGMKVMPVAQHVQIDLESVGLKLDWDHRQY
VSVQAGPQMWGKVGGLCGTLDGDTNTDLTSRTGKNLVTVKAFADAWRVEDHSELCQVENS
AEMEFGMDSCEQSKLQKAVSVCERLLANEKLGDCIKPFNYDALIRTCMADYCNCANREHP
ESCNCDAIAMLAKECAFKGIKLEHGWRNLEICPISCGFGRVYQACGPNVEPTCDSDLALP
ALKGACNEGCFCPEGTVQYKEACITRELCPCSLRGKEFKPESTVRKNCNTCTCKNGQWRC
TEDKCGARCGAVGDPHYQTFDGKRYDFMGKCSYHLLKTQNTSVEAENVACSGAVSEAMNF
AAPDDPSCTKAVTIRFILRDGTPSVIKLDQGLTTVVNDKPIAKLPKMLGLGEVLIRRASS
TFLTVEFADGIRVWWDGVSRVYIDAPPSLRGQTQGLCGTFNSNTQDDFLTPEGDVETAVE
PFADKWRTKDTCQFKAETHQGPHPCTLNPEKKVKAEKFCDWILQDIFQDCHFLVEPEQYY
EDCLYDTCACKDEMAKCFCPILSAYGTECMRQGVKTGWRMSVKECAAKCPMGQVFDECGD
GCALSCDDLPSKGSCKRECVEGCRCPHGEYVNEEGECVPKQKCHCSFDGMSFQPGYKEVR
PGEKFLDLCTCTNGVWDCQDAEPGDKDKYPPSSELRSKCEKQPYAEFTKCAPKEPKTCKN
MDKYVADSSDCLPGCVCMEGYVYDTSRLACVLPGNCSCHHAGKSYDDGEKIKEDCNLCEC
KAGNWKCSKNGCESTCSVWGDSHFTTFDGHDFDFQGACDYVLAKGVFDNGDGFSITIQNV
LCGTMGVTCSKSLEIALTGHAEESLLLSADSAYITDPNKSPIRKLRDSVNSKGHNAFHIY
KAGVFVVVEVIPLKLQVKWDEGTRVYVKLGNEWRQKVSGLCGNYNGNSLDDMQTPSMGLE
TSPMLFGHAWKLQPHCSAPVAPIDACKKHPERETWAQLKCGALKSDLFKECHAEVPLDRF
WKRCIFDTCACDQGGDCECLCTAMAAYADACAQKGINIRWRSQHFCPMQCDPHCSDYKAC
TPACAVETCDNFLDQGIAERMCNRENCLEGCHIKPCEDGFIYLNDTYRACVPKAECKPVC
MVMDGKTFYEGDITYTDSCATCRCSKRKEICSGVKCDVPVTTGHSAPLIEGTTVATPLAT
QNQTKCVKGWTRWCDKDRDASDKSVRLNDEEKVPRYDRMENVYGTCLKQFMSKVECRVKD
THEAPEQMDENVVCSLEEGLRCIGKCHDYELRAFCQCDEKLEPEVAKPTEKPQLGLACDA
AVVEYKEFPGDCHKFLHCQPKGVEGGWIYVEKTCGEYMMFNPTVLICDHIATVTEIKPNC
GLIPKPEPEFEPIKQCPPGKIMSDCANQCEHTCHYYGTILRKRGLCQVGEHCKPGCVDEL
RPDCPKLGKFWRDEDTCVHADECPCMDKAEHYVQPHKPVLGEYEVCQCIDNAFTCVPNKP
EAVPKEGDVEVEVVPLIPIYPVTLTPPLQCSPERLIPKIENPAHSQPDSIFNASSQLAPE
HGPKMARLTKDQPLGSWSPSINDQMQYLELNFAKPEPFYGVVMAGSPEFDNYVSLFKILY
SHDGIAYHYLVDEMEKTQMFNGPLDSRAPVQTLFKIPVEASSLRIYPLKWHGSIAMRVEL
LICGDKEEPKPVPTLPTVPPVTDRPPRLVDLECIDLMGVDEGKMHQDQVQSSSLWQQPSL
GKKSQLLELLKVSTPLAWRPLANSQNEFIEFDFLEPRNISGFVTKGGPDGWVTGYKVLFS
KKKPTWNTVLSTDGQPRIFEANHDAETERRHHFKNPILTQYIKIVPAYWERNINMRIEPL
GCFLPYPEVQRQVPKEESKPTKCNVCDGVSSVSSVSSSTAGCQCQEQLFWDGSTCVQHNL
CPCIENYVSYPIGSKFENSACEECVCVLGGHKNCKPKKCPPCVDGKLRPVITSDCFCKCE
PCPKHQRLCPSSGDCIPEILWCNGVQDCADDEDASCSDSFTVEPDVSREKNETEVITCPV
PVCPPQMKIRITEKKSRKMSKMFTFSKQVSIVDDGTTITKTKFISSKEQVLAMPNQALDF
QEEEQCDEFTCVPIPSKQVDKNETVTCTEPKCPEKYDVELDMSAAKVGDCLRYTCVLRPN
KDDVCEISGKSFTTFDGTVFKYGPCSHILARDIHNSSWSISVHQQCSDETRKVCHKVITI
QDTEAGNELILLPQLKLKFNGFEFTVQQLINSPICKASFVVSQPGKTLLAVSTKYGFWVQ
LDDIGIVKVGISSKFIRTVDGLCGYYNGNPKDDKRSPDGQIIPNTEKFGDSWYDKRIPKD
QCGDLKCSREMQAKALQLCNIIHHPTFARCHKAVNYKQFLNNYCLEAACNCMMANNGDPA
ACKCNILESFVKKCLSVNPLVQLTTWRAVAQCEINCPAPLVHTDCYKRRCEPSCDNVHGD
DCPVLPDACFPGCYCPEGTVRKGPSCVPISECKDCVCNSLGASKYMTYDRKSFGFNGNCT
YLLSRDVVLPGVHTFQVYVSMDDCKKLGQATPVEGGSCAKSLHILNGDHVIHVQRVPQKP
KSLQVLVDGFEVKKVPFKDSWISLRQVVGKELVLSLLESHVELTASFEDLIFSLGVPSIQ
YGSKMEGLCGDCNGNAANDLQPNPAKKNAGVDVIQSWQADEPKLGLVEECLSEDVPKEHC
IPLPPEKDPCFQFYNDKLFGKCPLAIDPIAYVSACQQDICKPGNTQQGICVALAAYAKEC
NQHGICTNWRRPQLCPYECPSDMVYQPCGCAKNCDTIKALAEFDAVSLKNSAVVHTVKTD
EMCLSSERFEGCFCPAGKVMDGGKCVPEIACTKCDDGLHLPDEKWKKDKCTDCQCDSKGK
TTCVEKKCQVEENICAEGYRPETIFSVDECCPRYRCVPETKDPSKLCLAPLVPICGPGQF
KKEKKDVNGCSQYICECIPKDQCEIIKLRELLPGEVIVKVEEGCCPTQKIECKPDTCPQA
PVSCQERFYEVKTIEQPGMCCSKHSCVPPKDLCIVQYELDEATKFTKPVGEKWTHAKEVC
KQETCSYGPDGNAQVVSTLEQCLTDCAPGFSYQNLDKTKCCGKCVQTSCIFEQKLYDVNA
LWKSADNCTTYSCLKKDGQFLVTTSKEVCPNVDSCLSHLLYQDGCCKRCKSEPLVQDKST
CLPVSLAESRTKEILKFPVQGHGTCVNADPIQGFTDCEGSCSSGSKYNTLTDMHEKFCTC
CSIQSYHPISVKMICEDGHTFTQKHEVPSNCGCSPCSEFSDTAIDVRMQQDVQSPLLQLL
GNHRH
Download sequence
Identical sequences B3NHH5
XP_001972675.1.56816 FBpp0134201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]