SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0134340 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0134340
Domain Number 1 Region: 62-112
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000198
Family EGF-type module 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0134340   Gene: FBgn0108033   Transcript: FBtr0135848
Sequence length 217
Comment type=protein; loc=scaffold_4784:16209217..16209870; ID=FBpp0134340; name=Dere\GG15794-PA; parent=FBgn0108033,FBtr0135848; dbxref=FlyBase:FBpp0134340,FlyBase_Annotation_IDs:GG15794-PA,GB_protein:EDV51942,REFSEQ:XP_001972916,FlyMine:FBpp0134340; MD5=972ddb119d0f25f075aa0e376cd01f64; length=217; release=r1.3; species=Dere;
Sequence
MRVQDLLLLATALIGVYLPLTAACSSRAIAKPRPTAAPILPPDNVEISTTPRPNVTFPIF
ACPPTYDAWYCLNDATCFTVKIHNEMLYNCECALGFMGPRCEYKEIDGSYLPTRNRVMLE
KASIVSGATLALLFMAMCCVLLYLRHEKLQKQKLHDSTTTTTTDGGCQNEGMDEVDGLRP
LRPVRRPFGPCRILSLEEAYLQAAASNRPRHCNELLR
Download sequence
Identical sequences B3NHS7
FBpp0134340 XP_001972916.1.56816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]