SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0134609 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0134609
Domain Number 1 Region: 440-565
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000188
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 2 Region: 332-384
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000876
Family EGF-type module 0.016
Further Details:      
 
Domain Number 3 Region: 291-335
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000031
Family EGF-type module 0.013
Further Details:      
 
Domain Number 4 Region: 377-422
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000479
Family EGF-type module 0.0099
Further Details:      
 
Weak hits

Sequence:  FBpp0134609
Domain Number - Region: 183-327
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00283
Family Growth factor receptor domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0134609   Gene: FBgn0108298   Transcript: FBtr0136117
Sequence length 833
Comment type=protein; loc=scaffold_4770:join(6482517..6482573,6487765..6488076,6491744..6491810,6495634..6495882,6498813..6498867,6500929..6502690); ID=FBpp0134609; name=Dere\GG16063-PA; parent=FBgn0108298,FBtr0136117; dbxref=FlyBase:FBpp0134609,FlyBase_Annotation_IDs:GG16063-PA,GB_protein:EDV48504,REFSEQ:XP_001979546,FlyMine:FBpp0134609; MD5=e731275c9b0819dac6d0551374a7d41d; length=833; release=r1.3; species=Dere;
Sequence
MHWIKCLLTAFICFTVIVQVHSSGSFELRLKYFSNDHGRDNEGRCCSGESDGTTGKCLGS
CKTRFRVCLKHYQATIDTTSPCTYGDVVTPILGENSVNLTDAQRFQNKGFTNPIQFPFSF
SWPGTFSLIVEAWHDTNNSGNARTNNLLIQRLLVQQVLEVSSEWKTNKSESQYTSLEYDF
RVTCDANYYGSGCAKFCRPRDDSFGHSTCSETGEIICLTGWQGDYCHIPKCAKGCEHGHC
DKPNQCVCQLGWKGALCNECVLEPNCIHGTCNKPWTCICNEGWGGLYCNQDLNYCTNHRP
CKNGGTCFNTGEGLYTCKCAPGYSGDDCENEIYSCDADVNPCQNGGTCIDEPHTKTGYKC
HCANGWSGKMCEEKVLTCSDKPCHQGICRNVRPGLGSKGQGYQCECPIGYSGPNCDLQLD
NCSPNPCINGGSCQPSGKCICPAGFSGTRCETNIDDCFGHQCENGGTCIDMVNQYRCQCV
PGFHGTHCSSKVDLCLIRPCANGGTCLNLNNDYQCTCRAGFTGKDCSVDIDECSSGPCHN
GGTCMNRVNSFECVCANGFRGKQCDEESYESVTFDAHQYGATTQARADGLTNAQVVLIAV
FSVAMPLVAVIAACVVFCMKRKRKRAQEKDDAEARKQNEQNAVATMHHNGSAVGVALASA
SLSGKTGSNSGLTFDGGNPNIIKNTWDKSVNNICASAAAAAAAAAAADECLMYGGYVASV
ADNNNANSDFCVAPLQRAKSQKQLNTDPTLMHRGSPAGSSAKGASGGGPGAAEGKRISVL
GEGSYCSQRWPSLAAAGVAGACSSQLMAAASAAGSGAGTAQQQRSVVCGTPHM
Download sequence
Identical sequences B3P352
XP_001979546.1.56816 FBpp0134609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]