SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0134625 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0134625
Domain Number 1 Region: 3647-3862
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.07e-35
Family Laminin G-like module 0.0022
Further Details:      
 
Domain Number 2 Region: 3027-3131
Classification Level Classification E-value
Superfamily Cadherin-like 4.43e-30
Family Cadherin 0.0011
Further Details:      
 
Domain Number 3 Region: 2923-3026
Classification Level Classification E-value
Superfamily Cadherin-like 1.04e-28
Family Cadherin 0.0009
Further Details:      
 
Domain Number 4 Region: 3133-3244
Classification Level Classification E-value
Superfamily Cadherin-like 1.23e-28
Family Cadherin 0.0003
Further Details:      
 
Domain Number 5 Region: 821-936
Classification Level Classification E-value
Superfamily Cadherin-like 1.24e-27
Family Cadherin 0.0013
Further Details:      
 
Domain Number 6 Region: 2706-2819
Classification Level Classification E-value
Superfamily Cadherin-like 1.33e-27
Family Cadherin 0.00063
Further Details:      
 
Domain Number 7 Region: 2186-2293
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-26
Family Cadherin 0.001
Further Details:      
 
Domain Number 8 Region: 1453-1576
Classification Level Classification E-value
Superfamily Cadherin-like 6e-26
Family Cadherin 0.00097
Further Details:      
 
Domain Number 9 Region: 1140-1252
Classification Level Classification E-value
Superfamily Cadherin-like 6.57e-26
Family Cadherin 0.0013
Further Details:      
 
Domain Number 10 Region: 723-825
Classification Level Classification E-value
Superfamily Cadherin-like 1.18e-25
Family Cadherin 0.00084
Further Details:      
 
Domain Number 11 Region: 1040-1152
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-25
Family Cadherin 0.0011
Further Details:      
 
Domain Number 12 Region: 2397-2506
Classification Level Classification E-value
Superfamily Cadherin-like 3e-25
Family Cadherin 0.0012
Further Details:      
 
Domain Number 13 Region: 492-624
Classification Level Classification E-value
Superfamily Cadherin-like 4.57e-25
Family Cadherin 0.002
Further Details:      
 
Domain Number 14 Region: 392-504
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-24
Family Cadherin 0.0012
Further Details:      
 
Domain Number 15 Region: 1347-1459
Classification Level Classification E-value
Superfamily Cadherin-like 8.85e-24
Family Cadherin 0.0013
Further Details:      
 
Domain Number 16 Region: 168-300
Classification Level Classification E-value
Superfamily Cadherin-like 1.43e-23
Family Cadherin 0.0036
Further Details:      
 
Domain Number 17 Region: 927-1058
Classification Level Classification E-value
Superfamily Cadherin-like 4.85e-23
Family Cadherin 0.00096
Further Details:      
 
Domain Number 18 Region: 1662-1785
Classification Level Classification E-value
Superfamily Cadherin-like 7.14e-23
Family Cadherin 0.0016
Further Details:      
 
Domain Number 19 Region: 1980-2087
Classification Level Classification E-value
Superfamily Cadherin-like 3.57e-22
Family Cadherin 0.002
Further Details:      
 
Domain Number 20 Region: 3232-3355
Classification Level Classification E-value
Superfamily Cadherin-like 5.14e-22
Family Cadherin 0.0015
Further Details:      
 
Domain Number 21 Region: 603-722
Classification Level Classification E-value
Superfamily Cadherin-like 7.14e-22
Family Cadherin 0.00085
Further Details:      
 
Domain Number 22 Region: 1266-1359
Classification Level Classification E-value
Superfamily Cadherin-like 1.41e-18
Family Cadherin 0.0036
Further Details:      
 
Domain Number 23 Region: 2813-2922
Classification Level Classification E-value
Superfamily Cadherin-like 4.43e-17
Family Cadherin 0.0015
Further Details:      
 
Domain Number 24 Region: 1566-1668
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-16
Family Cadherin 0.0029
Further Details:      
 
Domain Number 25 Region: 2499-2605
Classification Level Classification E-value
Superfamily Cadherin-like 6.14e-16
Family Cadherin 0.0018
Further Details:      
 
Domain Number 26 Region: 2089-2193
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000171
Family Cadherin 0.0027
Further Details:      
 
Domain Number 27 Region: 2294-2392
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000114
Family Cadherin 0.0046
Further Details:      
 
Domain Number 28 Region: 1778-1876
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000157
Family Cadherin 0.0032
Further Details:      
 
Domain Number 29 Region: 2611-2704
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000343
Family Cadherin 0.004
Further Details:      
 
Domain Number 30 Region: 1885-1992
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000914
Family Cadherin 0.0069
Further Details:      
 
Domain Number 31 Region: 3346-3440
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000343
Family Cadherin 0.006
Further Details:      
 
Domain Number 32 Region: 3978-4020
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000408
Family EGF-type module 0.01
Further Details:      
 
Domain Number 33 Region: 59-180
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000557
Family Cadherin 0.0032
Further Details:      
 
Domain Number 34 Region: 3872-3909
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000002
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 35 Region: 289-397
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000557
Family Cadherin 0.019
Further Details:      
 
Domain Number 36 Region: 3908-3947
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000839
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 37 Region: 3622-3666
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000252
Family EGF-type module 0.02
Further Details:      
 
Domain Number 38 Region: 3950-3988
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000028
Family EGF-type module 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0134625   Gene: FBgn0108314   Transcript: FBtr0136133
Sequence length 4446
Comment type=protein; loc=scaffold_4784:join(19741319..19743208,19744784..19745879,19745936..19746042,19746107..19746314,19746374..19746435,19746494..19746649,19746724..19747096,19747158..19748166,19748226..19748411,19748478..19748652,19748709..19748971,19749026..19749752,19749811..19749988,19750049..19750489,19750554..19750954,19751020..19751328,19751391..19752414,19752688..19756683,19756748..19757029,19757102..19757290,19757823..19757954,19758016..19758152); ID=FBpp0134625; name=Dere\GG16079-PA; parent=FBgn0108314,FBtr0136133; dbxref=FlyBase:FBpp0134625,FlyBase_Annotation_IDs:GG16079-PA,GB_protein:EDV52449,REFSEQ:XP_001973423,FlyMine:FBpp0134625; MD5=3ab4434c336cea44c00fe0df4252fcf3; length=4446; release=r1.3; species=Dere;
Sequence
MKIKKYVTPVKRKAFTIFQWISLLCSLWLIPTVQSKADEKHTATLEYRLENQLQDLYRFS
HSVYNVTIPENSLGKTYAKGVLHERLAGLRVGLNAEVKYRIISGDKEKLFKAEEKLVGDF
AFLAIRTRTNNVVLNREKTEEYVIRVKAHVHLHDRNISSYETEANIHIKVLDRNDLSPLF
YPTQYTVVIPEDTPKYQSILKVTADDADLGINGEIYYSLLIDSEYFAIHPTTGEITLLQQ
LQYAENSHFELTVVAYDRGSWVNQQNHQASKAKVSISVKQVNFYAPEIFTKTFSSVTPTS
NPLIYGIVRVNDKDTGINGNIGRLEIVDGNPDGTFLLKAAETKDEYYIELNQFAHLSQQH
FIYNLTLRAEDLGTPRRFAYKSVPIQIKPESKNIPIFTQEIYEVSIPETAPINMPVIRLK
VSDPDLGKNALVYLEIVGGNEGDEFRINPDSGMLYTAKQLDAEKKSSYTLTVSAIDQANV
GSRKQSSAKVKISVQDMNDNDPIFENVNKVISINENNLAGSFVVKLTAKDRDSGENSYIS
YSIANLNAVPFEIDHFSGIVKTTSLLDFETMKRNYELIIRASDWGLPYRRQTEIKLSIVV
KDINDNRPQFERVNCYGKVTKSAPMGTEVFELSINESVQLGETVAWIEAKDRDLGYNGKL
VFAILDGDYDSVFRIDPDRGELQIIGYLDRERQNEYVLNITVYDLGNPTKSTSKMLPITI
LDVNDNRPVIQKTLATFRLTESARIGTVVHCLHATDADSGINAQVTYALSVECSDFTVNA
TTGCIRLNKQLDREKQDNYALHITAKDGGNPVLSSEALVYVLVDDVNDNAPVFGVQEYIF
KVREDLPRGTVLAVIEAVDEDIGPNAEIQFSLKEETQDKELFRIDKHTGAIRTQGYLDYE
NKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDVNENRFAPEFDDFVYEGKIKENKPKGTFV
MNVSARDMDTVDLNSKITYSITGGDGLGIFAVNDQGSITSLSQLDAETKNFYWLTLCAQD
CAIVPLSNCVEVYIQLENENDNIPLTDKPVYYVNVTEASLENVEIITLKAFDPDIDPNQT
LTYNIVSGNLVGYFEIDSKTGVIKTTERKLDRENQAEHILEVAISDNGSPVLSSTSRIVV
SVLDINDNSPEFDQRVYKVQVPSSATVNQSIFQVHAIDSDSGENGRITYSIKSGKGKNKF
RIDSQRGHIHIAKPLDSDNEFEIHIKAEDSGIPKKSQTARVNIVVVPVNPDSQNAPLIVR
KTSENVVDLTENDKPGFLVTQILAVDDDNDQLWYNISNGNEDNTFYIGQDNGNILLSKYL
DYETKQFYNLTISVTDGTFTTLTNLLVQVIDINDNPPQFAKDVYHVNISENIEEESVIMQ
LHATDRDEDKKLFYHLHATQDPSSLALFRIDSISGNVIVTQRLDFEKTAQHILIVFVKDQ
GAPGKRNYAKIIVNVHDHNDHHPEFTAKIIQSKVPESAAIGSKLAEVRAIDRDSGHNAEI
QYSIITGNVGSVFEIDPTFGVITLAGNLNINKIQEYMLQVKAVDLGNPPLSSQIPVHIIV
TMSENDPPKFSTNTIAIEIFENLPIGTFVTQVTARSSSSIFFNIISGNIHESFRINPSTG
VIVINGNIDYESIKVFNLTVKGTNMAAESSCQNIIIHILDANDNIPYFVQNEYVGALSES
ASIGSYVLKVYDSSKDHLTLQVKDADVGVNGMVEYHIIDDLAKQFFKIDSTTGAIELLRQ
LDYETNAGYTFDVTVSDMGKPKLHSTTTAHVTIRVINVNDCPPVFNERELNVTLFLPTFE
NVFVRQVSAKDADNDTLRFDIVDGNTNECFQIEKYTGIITTRNFEILNENDRDYTLHVRA
SDGIFSAILIVKIMVLSAIDLNFAFQRESYRFSAFENNTKIATIGLVNVVGNSLNENVEY
RILNPTQLFDIGISSGALKTTGVIFDREVKDLYRLFVEAKSVLYDGMNSNVRRAVTSIYI
SVLDVNDNCPLFVNMPYYATVSIDDPKGTIIMQVKAVDLDSAENGEVRYELKKGNGELFK
LDRKTGELSIKQHVEGHNRNYELTVAAYDGAITPCSSEAPLQVKVIDRSMPVFEKQFYTV
SVKEDVEMYSALSVSIEAESPLGRSLIYTISSDSQSFEIDYNTGSIFVVNELDYEKISSH
DVSIRATDSLSGVYAEVVLSVSIMDVNDCYPEIESDIYNITIPENSSFGTQILKINATDK
DSGANAKLSYYIESINGQNNSELFYIDVTDGNLYLKTPLDYEQVKYHHVVVNVKDHGSPS
LSSRSNVFITVKDLNDNAPCFVEPSYFTKLSVAAVRGQFVALPKAYDKDISDTDSLEYKI
VYGNELQTYSIDQLTGVISLQNMLNFTDKSSTVLNISVSDGVHTTYARLKISLLPENVYS
PQFDQNTYEVQVPENLLHGHNIITVKASDGDFGTYASLYYEIVSEEMKKIFLIDQSTGVI
TSKVTFDREKKDEYVVQLKVSDGGGKFGFASLKVIVVDVNDNVPYFLLKEYKMVVSITTE
ANRTILTVKAKDDDINDNGSVYYQIVEKTIDEAVKDVIEINEKTGDIAFKMNAESYGVNS
YQFFVRATDRGETQFHSEVPVSIEIIETDAHIPTFEKSSVLLKIIESTPPGTVLTKLHMI
GNYTFKFSIAADQNHFMISDSGELILQQTLDREQQESHTLIVMAETSTVPVFFAYADVLI
DVRDENDNYPKFDNTFYSASVAENSEKVISLVKVSATDADTGPNGDIRYYLESDTENIQN
IFDIDIYSGWITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFK
LPIERLSVFENALPGTVLINLLLIDPDIEKQEMDFFIVSGDKQAQFQIGADDFTIGKESG
ILKVASALDRETTPKYKLVAHVQDGKDFTQECFSEIIITVNDINDNTPIFSMAQYRVSAP
EDAQLNTLITKVHAMDKDFGVNRQIKYSLMGENHDYFKISKSTGIIRLDKSLDRETISLF
NLTVKAEDCGVPKLHSIATVAVNILDINDNPPEFSMRQYSCEILENATHGTEVCKVYATS
IDIGVNADIHYFIMSGNEQGKFKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPLS
NNAYVNISILDINDNSPKFLQNLYRVNVNEDIFVGSKILDIKATDEDSDINGLVTYNIEK
GDNIGQFSIDPKNGTISVSRPLDRETIPHYTLEIQACDQGNPQRCNSVPININILDTNDN
APIFSSANYSVVLQENRPLGYVFLTFKITDADESPNTTPYTFDIRSGNEGGLFRLEQDGS
LSTASRFNHNLQDEFVIQVRVFDNGTPPLYSDAWVAVKIIEESQYPPIVTPLEVTINSFE
DDFSGAFIGKVHASDQDKYDELNFGLVSGPEDMYQSSKLFNISNNTGKIYAISNLDIGLY
KLNVSVSDGKFHVFSPVKINVELVTNDMLKESVVIRFSSISASEFLLSHRKTFMRSIRNI
MRCRQKDVILITLQSERIRTGGNRRARSIGSDLNVVFAVRKQQIIPDSDEFFTSDEIRQT
LVDKKNEIENETNLVVDDILPSTCQSNKNDCVHGECKQVLQILKNNVTTTFTDVISFAAP
SYIQVNTCVCRPGFDGKHCKETVNACSTDPCSPQRICMPSGSALGYQCVCPKGFSGTYCE
RKSSKCSNESCDMGLFTAVSFGGKSYAHYKINKVKAKFTLENEFSYSLQIRTVQQTGTLL
YASGKVDYNILEIINGAVQYRFDLGSGEGVISVSSINISDGEWHQISLERSLNSAKVMVD
NKHVSHGSAPGVNGILNIQSNDIFVGAEVRPHPSIIGYEDIQRGFIGCMANIKIAKESLP
LYISGGSTIAALKRFTNVEFKCDPSNVLVRLGICGSQPCANSGICKELDTDVFECACQPR
YSGKHCEIDLDPCSSGPCLFGGRCDYHGPNNYSCTCPIHLSGKRCEYGKFCTPNPCKNGG
ICEEGDGISHCMCRGYTGPTCEIDVDECENQPCGNGATCINEPGSFRCICPSYLTGASCG
DPLYSNSISTKLKNFSIEHISGIIAGVAVVLVIIICVLCCVVVRRSSSSKRRNRLEKDKN
KPSYKEANLNSLVDKDNYCKPNVKLSNLEVNQRPISYTAAPNDNLFLSNRNFVNNLDILR
SYGSAGDELENVPFEYQKVNRNKQHVNINSCHSTDADNAYKQEWCEQMHLRTFSENKLNN
ELKRDFGPSVSRFSTGKLIQVEMPNVCHSSSANFVDYSALANGQYHWDCSDWVRKSHNPL
PDITEVPGAEIADSSSLHSNDSNESKSKKAFFVHREDGDVDPTRDITALNEDIGSEYLDS
EAESCLEPFMLPRSSNQPLSRLSSFNNIENEDYKSNTGKVYLRHPDSYLPTMHFPSETDG
ESSMTEGPISRKEMKTRRTISENSEEAYLFPCAVGEIGSNSNISVRLCEIEDSELEEFLP
QQQTNN
Download sequence
Identical sequences FBpp0134625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]