SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0135003 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0135003
Domain Number 1 Region: 185-330
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000091
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 2 Region: 61-186
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000612
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 3 Region: 20-52
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000802
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0135003   Gene: FBgn0108688   Transcript: FBtr0136511
Sequence length 451
Comment type=protein; loc=scaffold_4512:join(1063996..1064068,1066308..1066390,1068509..1068647,1069402..1069846,1069905..1070037,1070729..1070817,1073280..1073510,1073573..1073735); ID=FBpp0135003; name=Dere\GG16457-PA; parent=FBgn0108688,FBtr0136511; dbxref=FlyBase:FBpp0135003,FlyBase_Annotation_IDs:GG16457-PA,GB_protein:EDV45263,REFSEQ:XP_001982744,FlyMine:FBpp0135003; MD5=6b1518639eb14e781e9e601ccb290901; length=451; release=r1.3; species=Dere;
Sequence
MFYKLCAFMCFLIIVEHITTTMSSDINECSINNHNCLPTQRCDNTIGSYICTIQMNVLKK
NPCAIHERCINTNGHFRCESLIQCSPGYKSTADGKSCIDIDECDTGEHNCGERQICRNRN
GGFVCSCPIGHELKRHSNGSSTCVDTDECALEQRVCQLNAQCFNTIGSYYCECKSGFQKK
SDGNNSTQCFDIDECQVIPGLCQQKCLNFWGGYRCTCNSGYQLGQDNRTCNDINECEVHK
DYKLCMGLCINTPGSYQCSCPRGYMLSADMNTCRDVDECATDSINQVCTGRNDICTNIRG
SYKCTTINCPLGYSIDPEQKNRCRQGTNFCEGEDCYTKPSAYTYNFITFVSKLMIPPEGR
TIFTLRGPLWYDNIDFDLQIVRIQATTHIQRATDGCFDTLKNNNQVNVILKKSLEGPQDI
ELELSMTVYTNGMPRGKSVAKLFLFVSQHTF
Download sequence
Identical sequences FBpp0135003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]