SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0136202 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0136202
Domain Number - Region: 332-362
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000164
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 366-393
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000798
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 301-327
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00152
Family EGF-type module 0.023
Further Details:      
 
Domain Number - Region: 402-431
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00229
Family EGF-type module 0.025
Further Details:      
 
Domain Number - Region: 265-299
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00548
Family EGF-type module 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0136202   Gene: FBgn0109878   Transcript: FBtr0137710
Sequence length 439
Comment type=protein; loc=scaffold_4690:complement(15593897..15593937,15593998..15594195,15594263..15594358,15595318..15595506,15596132..15596326,15596411..15596668,15596764..15597106); ID=FBpp0136202; name=Dere\GG17656-PA; parent=FBgn0109878,FBtr0137710; dbxref=FlyBase:FBpp0136202,FlyBase_Annotation_IDs:GG17656-PA,GB_protein:EDV47408,REFSEQ:XP_001978481,FlyMine:FBpp0136202; MD5=2ebc810e2bcdab94bf52a230a1c0243c; length=439; release=r1.3; species=Dere;
Sequence
MTHQGTGCLVKWLYLVLIVHTLLCLGQIECRQNQNRNNNNNNKRADSSSSEEGHVNSSDL
LDNFADQDASFVSHGHQPRRGQRKKGGGGGSRHNRNEESGISLWINEQQLKMLTALYFPQ
GYSERLYAIHNSRVTNDLRDTTLYNFLVIPSEVNYVNFTWKSGRRKYFYDFDRLQTMDES
ILKAPTLSIRKSGRIPQEQKNFSIFLPCTGNSSGTASFNVGLKIQTRNNKPLSGTPIRLN
FKKECAHRGVYDIDASNPTSLTTLQECSLKCGKNGYCNDHHICKCNVGYTGQYCETAFCF
PQCLNGGNCTAPSVCTCPEGYQGTQCEGGICKDKCLNGGKCIQKDKCQCSKGYYGLHCEY
SKCVIPCKNDGRCIGNNLCRCPNGLRGDHCEIGRKQRSICKCRNGTCVSHKHCKCHPGFY
GRHCNGRKRHIHRNNDSKF
Download sequence
Identical sequences FBpp0136202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]