SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0136259 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0136259
Domain Number 1 Region: 1248-1317,1349-1441,1480-1524
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 1.44e-17
Family All0351-like 0.024
Further Details:      
 
Domain Number 2 Region: 659-684
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000395
Family EGF-type module 0.05
Further Details:      
 
Weak hits

Sequence:  FBpp0136259
Domain Number - Region: 910-979
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000369
Family Pre-dockerin domain 0.075
Further Details:      
 
Domain Number - Region: 730-753
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000574
Family Integrin beta EGF-like domains 0.057
Further Details:      
 
Domain Number - Region: 629-653
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00073
Family Integrin beta EGF-like domains 0.091
Further Details:      
 
Domain Number - Region: 760-785
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00179
Family Integrin beta EGF-like domains 0.067
Further Details:      
 
Domain Number - Region: 265-291,323-405
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00759
Family beta-sandwich domain of Sec23/24 0.024
Further Details:      
 
Domain Number - Region: 788-824
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0144
Family EGF-type module 0.029
Further Details:      
 
Domain Number - Region: 564-588
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0227
Family EGF-type module 0.074
Further Details:      
 
Domain Number - Region: 593-620
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0419
Family Integrin beta EGF-like domains 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0136259   Gene: FBgn0109935   Transcript: FBtr0137767
Sequence length 3011
Comment type=protein; loc=scaffold_4690:complement(14621083..14624975,14629462..14630027,14632409..14633793,14634314..14634506,14634728..14634895,14638501..14638620,14653886..14654093,14654246..14654392,14657719..14657904,14659661..14659870,14661784..14661978,14662051..14663256,14672608..14672714,14674941..14675246,14717707..14717852); ID=FBpp0136259; name=Dere\GG17713-PA; parent=FBgn0109935,FBtr0137767; dbxref=FlyBase:FBpp0136259,FlyBase_Annotation_IDs:GG17713-PA,GB_protein:EDV47309,REFSEQ:XP_001978382,FlyMine:FBpp0136259; MD5=05e7b1291f8a0f03fc1177480d775268; length=3011; release=r1.3; species=Dere;
Sequence
MTMKSMKYSDCDTIMDGYNPVPPPLPRRVPPVRNIYAEPFAHEPNHSSRLGGHPQQMPQS
MSTGSNTIGHGGIDRGGVGLPMGAGTMPGGVGGGPGGVAGGGPQVGVGPPGSGNGGNCQI
SGSQPLVMPGFPLRNSHSAHAPHYSPYSPSRFHIDKRCQHRCSWKCLSIALIFVSVVLTA
MLAYFAAVSSMKPNMDSTNCILVQDVKSQPHDLRGGLAKSNEKGVATAFPTEESIQTSTS
DHGQNGHGLMNPSAGSGGSNSGIQQQLLLQQQQPHSINQPLTPLDATNTHLQDHHQLTYG
GALAGGVGGIGLSGGGMMNGGLNGGMGGQLMQQAGGGLNGHHHQALQPQLGGVVELKEFN
EAYHATIPAYQFWTLEFRNKHPAFIRFNFTLPWGAHFAVYSRRNVAPSVTQHDFVEFIKG
GRLDSHLRHRRSSANASTSGQDVELYRQDKDQSADSAQDQDSEQDESRSFDSSESYDVET
PLDTAKQHLQRIGKPQSHWVNKRSAGDGLPALDVDAMTVNVSLLQYLDTGLWFISVYNDE
LVAHSVSLLAEEAEGVSTTCPNDCSGRGSCYLGKCDCIDGYQGVDCSKSVCPVLCSAHGH
YGGGVCHCEEGWKGAECDIPVGECEVPNCSSHGRCIEGECHCERGWKGPYCDQHDCLDPL
CSGHGTCVAGQCYCKAGWQGEDCGTIDQQVYQCLPGCSEHGTYDLETGQCVCERHWTGPD
CSQAVCSLDCGRNGVCESGKCRCNSGWTGNLCDQLPCDSRCSEHGQCKNGTCVCSQGWNG
RHCTLPGCENGCSRHGQCTLENGEYRCDCIEGWAGSDCSIALELNCKDNIDNDGDGMTDC
SDSECCSHPACSEHIMCLSSNDPVEVLLRKQPPSVTASFYQRVKFLIEENSVQSYAHMDE
YSENRVSVMRGQVITPQGLGIVGIRVSVDRDSRFGFTLTRQGGWFDVLVNGGGAVTLQFQ
RSPFRPLTRTVFVPWNRIVVLPPVQMQLSDDDETTSRNIKVAPLNPALTFLNSIHYHTAD
EANDASKVCMDHDHEKLRPQLISTWMPNGVGAMPGKRVIFAETQIVQESIQIPGSDLHLT
YQSSQASGYLSIVRMRLTGETIPPTLTHVHVGVEIEGALHVKTYEADPSLVHTFAWNKRN
VYRQKVYGVTVARISVGYQHSTCQLPVWIAQTAKLQGYDVDISDIGGWGLDIHHHYNFHE
GILQKGDGSTLHMKEYPRTVKVVMGTGLQRPLTCPDYCNGVAKDAKLLTPIALATGPDGS
LYVGDFNLVRRITPDGKVYTILQLSATQVSYQYYLAVSPADGHLYISDPERHQILRLVRL
EKVKDPSINSDPVVGSGQRCIPGDEGNCGDGGLALLARLSHPKGLAIAADRTMYIADGTN
IRAVDPKGVIHTLIGHHGHHNHWSPAPCSGTLMANQAQLQWPTGLALSPLDGSLHFIDDR
LVLRLTSDMKIRVVAGTPLHCSNGGQDGRVNKTGADNVLGTVLAMAFSPFGNLYIADSDS
RRVNSIRVVDTAGNMRYFAGKQEGTGSQTCDCAIGGGSNGSAAHSGVGGAGGGGAYSTTV
NPTRPNGGTTPTTPSGGNGSGNGNGSSASSAGGSAGGGGSNGGGGGASGGACICAGGIAL
STGSGSNSGTGSNGGGTLASIVGSGGLMSTGPTTTTTVLLGAKTTAAGIGGGAATLNDDG
TLSNAETLLSSNARFQAISAIAVAQDGVINVADQGSLHVLALEHYLPSHDENGEFHIPFP
PSSEIYVFNRYGQHVATKDLTSGKTRYSFLYSKNTSFGRLSTVTDASGNKIQFLRDYSNV
VSSIENTQDHKSEIQINGIGIMTKLSEKGRQEIELDYDSNTGLLNSRSSGGETYIYQYDE
FGRVTGMILPSGEIVRITSQLADSQGLTVYVHASVESLFSRERIAGEANELLVLGGVRST
FLKRGQAHADAELKANNTLVIHGDNGVVVEASAVARHPLLEAALPVEAEMLAMWSHQSVT
MGEGLTNSMYSVYSLVGDVRNPQQTLNREIWVNQSRVIGVEFDQFTNRETFYDARRTPIL
IVAYDQSGLPKSYYPTNGYPVNITYDRFNRVEGWAWGPAELKYSYDRHGLLSEITSQQDG
IVSFVYNDWNLVSEIGLASQRKFVLQYDDAGGLRHVVLPSGTRHSFSMQTSIGFIRCTYT
PPGSTRAYLQHYSHAGALLQTILPGDGARIVYRYNAAGQLTEVVHGDGRSEFQYNEATGM
PSTVSHTERELEYRWDFEYAAGLLAEERIDYVAKTGLSNAKFSYEYDSQLRVVALQGRIG
GQSLPTQAFAYDPRTGRPSLIGQFRFSQPALNQTQLHDGTASFTRTVDGRFQTQRMALAI
HRLEVFRMEFSYGVHGRISQTRTYTRNMAVNSYTNVKNYTWDCDGQLVGVEAQEPWGFRY
DDNGNLLSLTYRGNTIPMEYNAQDRIVKFGEGQYKYDARGLVAQNAREERFHYNTQGLLV
RASKRGRFDVRYYYDHLKRLTTRKDNFGNVTQFFYTNQQRPYEVSQIYSPRDGKLMSLTY
DDVGHLIYAQVYRHKYYVATDQSGTPLMLFNQYGEGIREIMRSPFGHIVYDSNPYLYLPI
DFCGGILDQVTTLVHMGDGRVYDPLIGQWMSPDWQRVAERIITPTRLHLYRFNGNDPINV
GHERHYPEDFAAWMRTLGYNVGNLVPQLARDLWQPPALWGRPPANPVALNLRRPFDNIPT
MAVESGFLAHLNVRRMSDFEQLSAPPRSALKCDVMDPSPKTIGSDTEPPFGKGIVVSRTA
DGQAIVSSVPAANAIYRDVYTSVFNRSKLLPFTFVVHNAQQDSFFFVKEDAWRATEDRQQ
LKRLQGQVNTTFHEITREATVGNGPAGAASGGAGSSSSSSSSSGGGSSSNTGNYLDVKIH
GAHAIINLRYGTTVAKEQQRLMHHAKLTAVRKAWHREKEALRSGLTTALEWSQQETDEIL
KQSYANNYEGEYIHDVNLYPELAEDPYNIKFVKKKGATGGAAGVPNSRRRRRRSTDLIQE
DEEELHRPADC
Download sequence
Identical sequences B3NXD7
XP_001978382.1.56816 FBpp0136259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]