SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0136377 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0136377
Domain Number 1 Region: 401-659
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-46
Family YWTD domain 0.00000474
Further Details:      
 
Domain Number 2 Region: 1490-1732
Classification Level Classification E-value
Superfamily YWTD domain 1.83e-19
Family YWTD domain 0.0016
Further Details:      
 
Domain Number 3 Region: 737-952
Classification Level Classification E-value
Superfamily YWTD domain 4.45e-19
Family YWTD domain 0.0019
Further Details:      
 
Domain Number 4 Region: 1157-1193
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000956
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 5 Region: 1194-1233
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000017
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 1386-1425
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000171
Family EGF-type module 0.02
Further Details:      
 
Domain Number 7 Region: 347-391
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000238
Family EGF-type module 0.0041
Further Details:      
 
Domain Number 8 Region: 1283-1321
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000275
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 9 Region: 1116-1153
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000301
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 10 Region: 89-125
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000353
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 11 Region: 1070-1110
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000851
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 12 Region: 1412-1458
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000011
Family EGF-type module 0.0046
Further Details:      
 
Domain Number 13 Region: 226-263
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000017
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 14 Region: 183-218
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000406
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 15 Region: 665-702,988-1058
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000487
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 16 Region: 1242-1280
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000982
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 17 Region: 1337-1373
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000236
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 18 Region: 271-303
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000877
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 19 Region: 129-168
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000969
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 20 Region: 311-360
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000571
Family EGF-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0136377   Gene: FBgn0110052   Transcript: FBtr0137885
Sequence length 1978
Comment type=protein; loc=scaffold_4690:complement(12836711..12836881,12836951..12839376,12839435..12841984,12842055..12842468,12842662..12843037); ID=FBpp0136377; name=Dere\GG17831-PA; parent=FBgn0110052,FBtr0137885; dbxref=FlyBase:FBpp0136377,FlyBase_Annotation_IDs:GG17831-PA,GB_protein:EDV47122,REFSEQ:XP_001978195,FlyMine:FBpp0136377; MD5=a1b2318037d8df1d9dd8f9bf4f5d8174; length=1978; release=r1.3; species=Dere;
Sequence
MCQAEHQVPPSEQRIRLASPKMTVSPRGFNLTSQTRAHPTSGGSQSSSGYANCQRAHPIL
NGRHVAISLLLLLGLCGATAAGTPGSEDTRCNAGQFQCRDGGCILQAKMCDGRGDCKDSS
DELDCDYRLCRPPHWFPCAQPHGACLAAELMCNGIDNCPGGEDELNCPVRPGFRFGDTAH
RMRNCSKYEFMCEQDRTCIPIDFMCDGRADCADKSDEVAGCKQAEATCSAEGHLCDNGRC
LRRKHWVCDGVDDCGDGSDERGCQNLCKPEKGKFLCRNQETCLTLSEVCDGHSDCSDGSD
ETELCHSKPGCDGKNCVLGSKCHMMPTGGAECICPRGFRLAKFEDKCEDIDECKEQDDLC
SQGCENTSGGYRCVCDAGYLPDKDNRTCRAVVHGSIEQQPLLLYTTQMTIMGMHLHEDNV
RNHVYQVAGNLSKVIGVAYDGSHIYWTNIQNEAESIVKANGDGSHAEILLTSGLDAPEDL
AVDWLTQNIYFSDNIMRHIAVCSNDGLNCAVLVTQDVHQPRSLAVWPQKGLMFWTDWGEK
PMIGRASMDGSRSRPIVSDNIEWPNGIALDMHQQRIYWVDAKLGSVQTVRPDGTGRRTVL
DGMLKHPYGLAIFEDQLYWSDWATKSVHACHKFSGKDHRILAKDRTIYAVHIYHPAKQPI
SSHGCENAKCSHLCLLAEPEIGGHSCACPDGMRLAPDQQRCMLMEKRQRLFIGLGQALLE
VEHTAFGRHQVSKSYTLPCLINEMVYNRINGSLIIADNDQRLILEFQPEHHETNVLVRSN
LGNVSALAFDHLSRNLYWADMERGAIEMLSLQTRHRALIRFFPGQEVPIGLTVMPAEGYL
YVVLKAKRHSHIDKIPLSGKGEQVHVFEDDLGDDDIKLITDYETKTLFWSDSDLGRISYS
NYKVPHSQIFRGKLRRPYSLAMVHHDLFWNELGTPRIYWTHKSNMGPRKVIDVMEKGDPA
AILPYVPVAMPNGIPLAASSPAALESHPCQLQNGGCSHICVGEGPYHSICLCPAGFVYRD
AGNRTCVEALDCEFRCHSGECLTMNHRCNGRRDCVDNSDEMNCDEEHRRKPKVMCSPSQF
ACHSGEQCVDKERRCDNRKDCHDHSDEQHCEMFDKTKKCHVHQHACDNGKCVDSSLVCDG
TNDCGDNSDEMLCEATSRCEQGMFQCGSGSCIAGTWECDGRIDCSDGSDEHDKCAHRTCP
PDMHRCLLGQCLDRRLVCDGHNDCGDKSDELNCGTDSSTANISCTEDQFQCTSNLKICLP
SAVRCNGTAECPRGEDEADCGDVCSIYEFKCRSGRECIRREFRCDGQKDCGDGSDELSCE
LEKGNHNQSQIQPWSTSSRACRPHLFDCQDGECVDLSRVCNSFPDCTNGHDEGPKCATAC
RSASGRQVCQHKCRATPAGAVCSCFDGYRLDADQKSCLDIDECQEQQPCAQLCENTLGGF
QCQCHADFMLRQDRVSCKSLQSGATLLFSSFNEVRNLSEQPVMLNVAWSANDSRITGFDV
DMHRQMGYFSAEDEGIIYQIDLQTKMIVRALGLPTPTKLSVDWVTGNVYVLSGAQEIQAC
SFEGRMCGRIVHVKSPKHVKHLAADGYHGRIFYIVIRTEGYGQTSSEIHMARLDGSRRDM
LLQRSESFMTALTTDPHQQLLYFVDQHARTLERISYRLKMGTLRRPEIMLQKSNALMHPS
GLSVYENNAFIVNLGSVEAVQCALYGSRICHKISLNVLNAQDIVVAGKSRQPQKTSHPCA
HAHCHGLCLQADYGYECMCANRLVAEGERCPHGSGNEVAVLGSANSMELEQEHTGHIHWL
MALLILVAGALIAGLGYMYYQYRQRGHTDLNINMHFQNPLATLAGTKGFLEHERAEAGVG
FASETGTASSRGSNDTFTTTSASSSFAAQQFSVPNALQRLLRPRQATSGDPMAQELLLES
PRESNLHSLDGGGGECGAGRQVPNILVADVDDDAAKSARSAQFGGNYAGNDANARFVS
Download sequence
Identical sequences B3NVV7
XP_001978195.1.56816 FBpp0136377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]