SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0137192 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0137192
Domain Number 1 Region: 1869-2116
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.56e-53
Family Ankyrin repeat 0.00000000531
Further Details:      
 
Domain Number 2 Region: 566-697
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.83e-16
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 3 Region: 182-312
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000283
Family Growth factor receptor domain 0.0063
Further Details:      
 
Domain Number 4 Region: 730-772
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000132
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 5 Region: 1160-1202
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000531
Family EGF-type module 0.0033
Further Details:      
 
Domain Number 6 Region: 871-1003
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000863
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 7 Region: 503-545
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000154
Family EGF-type module 0.0044
Further Details:      
 
Domain Number 8 Region: 768-808
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000469
Family EGF-type module 0.0031
Further Details:      
 
Domain Number 9 Region: 806-849
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000607
Family EGF-type module 0.005
Further Details:      
 
Domain Number 10 Region: 1185-1321
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000769
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 11 Region: 465-507
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000131
Family EGF-type module 0.0023
Further Details:      
 
Domain Number 12 Region: 692-728
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000152
Family EGF-type module 0.0041
Further Details:      
 
Domain Number 13 Region: 1038-1075
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000286
Family EGF-type module 0.011
Further Details:      
 
Domain Number 14 Region: 426-464
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000393
Family EGF-type module 0.0017
Further Details:      
 
Domain Number 15 Region: 1393-1430
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000176
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 16 Region: 157-193
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000267
Family EGF-type module 0.017
Further Details:      
 
Domain Number 17 Region: 1001-1042
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000628
Family EGF-type module 0.0057
Further Details:      
 
Domain Number 18 Region: 308-347
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000103
Family EGF-type module 0.009
Further Details:      
 
Domain Number 19 Region: 1076-1118
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000113
Family EGF-type module 0.015
Further Details:      
 
Domain Number 20 Region: 1315-1352
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000138
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 21 Region: 1538-1570
Classification Level Classification E-value
Superfamily Notch domain 0.00000034
Family Notch domain 0.0025
Further Details:      
 
Domain Number 22 Region: 118-155
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000643
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 23 Region: 388-430
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000947
Family EGF-type module 0.011
Further Details:      
 
Domain Number 24 Region: 1498-1530
Classification Level Classification E-value
Superfamily Notch domain 0.00000144
Family Notch domain 0.0027
Further Details:      
 
Domain Number 25 Region: 349-387
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000179
Family EGF-type module 0.01
Further Details:      
 
Domain Number 26 Region: 1458-1490
Classification Level Classification E-value
Superfamily Notch domain 0.00000288
Family Notch domain 0.0017
Further Details:      
 
Domain Number 27 Region: 1130-1164
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000196
Family EGF-type module 0.025
Further Details:      
 
Domain Number 28 Region: 73-117
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000051
Family EGF-type module 0.013
Further Details:      
 
Domain Number 29 Region: 38-74
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000909
Family EGF-type module 0.029
Further Details:      
 
Weak hits

Sequence:  FBpp0137192
Domain Number - Region: 1354-1392
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000153
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 547-575
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0323
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0137192   Gene: FBgn0110856   Transcript: FBtr0138700
Sequence length 2680
Comment type=protein; loc=scaffold_4690:join(455721..455811,468102..468192,476096..476358,476425..476629,479439..479569,483769..489920,489984..490293,490357..490809,490878..491224); ID=FBpp0137192; name=Dere\GG18646-PA; parent=FBgn0110856,FBtr0138700; dbxref=FlyBase:FBpp0137192,FlyBase_Annotation_IDs:GG18646-PA,GB_protein:EDV45706,REFSEQ:XP_001976779,FlyMine:FBpp0137192; MD5=3b29adb3a63155f5a45742c2302c74b5; length=2680; release=r1.3; species=Dere;
Sequence
MHAVASLPASLSLLLLTLAFANLPNTVRGTDTALGPFSCTTVGCQNGGTCVTQLNGKTYC
ACDSHYVGDYCEHRNPCNSMRCQNGGTCQVTFRNGRPGISCKCPLGFDESLCEIAVPNAC
DHVTCLNGGTCQLKTLEEYTCACANGYTGDRCETKNLCASSPCRNGATCTALAGSSSFTC
SCPPGFTGDTCSYDIEECQSNPCKYGGTCVNTHGSYQCMCPTGYTGKDCDTKYKPCSPSP
CQNGGVCRSNGLSYECKCPKGFEGKNCEQNYDDCLGHLCQNGGTCIDGISDYTCRCPPNF
TGKFCQDDVDECAQRDHPVCQNGATCTNTHGSYSCICVNGWAGLDCSNNTDDCKQAACFY
GATCIDGVGSFYCQCTKGKTGLLCHLDDACTSNPCHADAICDTSPINGSYACSCATGYKG
VDCSEDIDECDQGSPCEHNGICVNTPGSYRCNCSQGFTGPRCETNINECESHPCQNEGSC
LDDPGTFRCVCMPGFTGTQCEIDIDECQSNPCLNDGTCHDKINGFKCSCALGFTGARCQI
NIDDCQSQPCRNRGICHDSIAGYSCECPPGYTGTSCEININDCDSNPCHRGKCIDDVNSF
KCLCDPGYTGYICQKQINECESNPCQFDGHCQDRVGSYYCQCQAGTSGKNCEVNVNECHS
NPCNNGATCIDGINSYKCQCVPGFTGQHCEKNVDECISSPCANNGVCIDQVNGYKCECPR
GFYDAHCLSDVDECASNPCVNEGRCEDGINEFICHCPPGYTGKRCELDIDECSSNPCQHG
GTCYDKLNAFSCQCMPGYTGQKCETNIDDCVTNPCGNGGTCIDKVNGYKCVCKVPFTGRD
CESKMDPCASNRCKNEAKCTPSSNFLDFSCTCKLGYTGRYCDEDIDECSLSSPCRNGASC
LNVPGSYRCLCTKGYEGRDCAINTDDCASFPCQNGGTCLDGIGDYSCLCVDGFDGKHCET
DINECLSQPCQNGATCSQYVNSYTCTCPLGFSGINCQTNDEDCTESSCLNGGSCIDGING
YNCSCLAGFSGANCQYKLNKCDSNPCLNGATCHEQNNEYTCHCPSGFTGKQCSEYVDWCG
QSPCENGATCSQMKHQFSCKCSAGWTGKLCDVQTISCQDAADRKGLSLRQLCNNGTCKDY
GNSHVCYCSQGYAGSYCQKEIDECQSQPCQNGGTCRDLIGAYECQCRQGFQGQNCELNID
DCAPNPCQNGGTCHDRVMNFSCSCPPGTMGIICEINKDDCKPGACHNNGSCIDRVGGFEC
VCQPGFVGARCEGDINECLSNPCSNAGTLDCVQLVNNYHCNCRPGHMGRHCEHKVDFCAQ
SPCQNGGNCNIRQSGHHCICNNGFYGKNCELSGQDCDSNPCRVGNCVVADEGFGYRCECP
KGTLGEHCEIDTLDECSPNPCAQGAACEDLLGDYECLCPSKWKGKRCDIYDANYPGWNGG
SGSGNDRYAADLEQQRAMCDKRGCTEKQGNGICDSDCNTYACNFDGNDCSLGINPWANCT
ANECWNKFKNGKCNEECNNAACHYDGHDCERKLKSCDSLFDAYCQKHYGDGFCDYGCNNA
ECSWDGLDCENKTQSPVLAEGAMSVVMLMNVEAFREIQAQFLRNMSHMLRTTVRLKKDAL
GHDIIINWKDNVRVPEIEDTDFARKNKILYTQQVHQTGIQIYLEIDNRKCTECFTHAVEA
AEFLAATAAKHQLRNDFQIHSVRGIKNPGDEDNGEPLANVKYVITGIILVILGLAFLGMV
LSTQRKRAHGVTWFPEGFRAPAAVMSRRRRDPHGQEMRNLNKQVALQSQGVGQPGAHWSD
DESDMPLPKRQRSDPVSGVGLGNNGGYASDHTMVSEYEEADQRVWSQAHLDVVDVRAIMT
PPAHQDGGKHDVDARGPCGLTPLMIAAVRGGGLDTGEDIENNEDSTAQVISDLLAQGAEL
NATMDKTGETSLHLAARFARADAAKRLLDAGADANCQDNTGRTPLHAAVAADAMGVFQIL
LRNRATNLNARMHDGTTPLILAARLAIEGMVEDLITADADINAADNSGKTALHWAAAVNN
TEAVNILLMHHANRDAQDDKDETPLFLAAREGSYEACKALLDNFANREITDHMDRLPRDV
ASERLHHDIVRLLDEHVPRSPQMLSMTPQAMIGSPPPGQQQPQLITQPTVISAGNGGNNG
NGNASGKQSSQTAKQKAAKKAKLIEGSPDNGLDATGSLRRKASSKKTSAASKKAANLNGG
LNPGQLTGGVPGVPPTNSAAQAAAAAAAAAAVAAMSHELEGSPVGVGMGGNLPSPYDTSS
MYSNAMAAPLANGGNPNTGAKQPPSYEDCIKNAQSMQSLQGNGLDMIKLDNYGYSMGSPF
QQELLNGQGLGMNGNGQRNGVGPGVLPGGLCGMGGLTGAGNGNSHEQGLSPPYSNQSPPH
SVQSSLALSPHAYLGSPSPAKSRPSLPTSPTHIQAMRHATQQKQFGGSNLNSLLGGANGG
GVVGGSGGGAGGPGPQNSPVSLGIISPTGSDMGIMLAPPQSSKSSAIMQTISPQQQQQQQ
QQQQQQQQQQQHQQQQQQQQQQQQQLGGLEFGSAGLDLNGFCGSPDSFHSGQMNPPSIQS
SMSGSSPSTNMLSPSSQHNQQAFYQYLTPPSQHSGGHTPQHLVQTLDSYPTPSPESPGHW
SSSSPRSNSDWSEGVQSPAANNLYISGGHQANKGSEAIYI
Download sequence
Identical sequences FBpp0137192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]