SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0137435 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0137435
Domain Number 1 Region: 276-321
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000103
Family EGF-type module 0.015
Further Details:      
 
Weak hits

Sequence:  FBpp0137435
Domain Number - Region: 184-208
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0131
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 243-282
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0274
Family EGF-type module 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0137435   Gene: FBgn0111096   Transcript: FBtr0138943
Sequence length 542
Comment type=protein; loc=scaffold_4690:join(4270426..4270563,4270618..4270756,4270817..4270975,4271204..4271395,4271445..4271505,4271669..4271799,4271857..4272665); ID=FBpp0137435; name=Dere\GG18889-PA; parent=FBgn0111096,FBtr0138943; dbxref=FlyBase:FBpp0137435,FlyBase_Annotation_IDs:GG18889-PA,GB_protein:EDV46111,REFSEQ:XP_001977184,FlyMine:FBpp0137435; MD5=d75cb91d516cacc40c1876805c3187e6; length=542; release=r1.3; species=Dere;
Sequence
MLPDKRAALLLVTAITALELVEITAYRRNFDARQSSNSNIPLWKQRACEKSQKQRQNAHY
ICDEKGDFKCLPGWQGDLCQVPMCRRSCDPMNGYCQRPGECRCRIGYSGELCDKCIPLPG
CQHGGCTKPFECICKPGWAGLFCTEPSCRSGCHSTRGYCEAPGECRCRIGYAGRTCSECA
TMPGCQHGTCNKPLECLCLPGYTGLLCQTPICDPDCSKQHGYCRKPGECRCKVGWTGSQC
DKCFPYPGCANGDCEAPWECNCHPGWGGMLCDEKLTYCVEHPDTCENGGKCTSLSREDGS
YQCQCRQGFLGKNCEIRDDFLLTSEAPPRITPPTPAKLDLELDGALDQLGEQDVGTGVPD
EKLGGEKLVAGNEPERRKNDTATAGAGAGPMNPVAGNGNSNSNATRTTMVVATGTVSHNA
TNEALSAVTTRRATPIPPTSGEKAVKGDATSVAAATAPQPRPPPPIGAGQEQTMATLAPT
PTAATAATSVTSHKDSPNVADEEEDEDDEDDEEDEDGEYDEEEDEDEDDEEDDSDQLIPN
II
Download sequence
Identical sequences B3NVC3
XP_001977184.1.56816 FBpp0137435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]