SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0137516 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0137516
Domain Number 1 Region: 561-671
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.49e-31
Family Spermadhesin, CUB domain 0.00055
Further Details:      
 
Domain Number 2 Region: 440-557
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.19e-29
Family Spermadhesin, CUB domain 0.00042
Further Details:      
 
Domain Number 3 Region: 89-132
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000011
Family EGF-type module 0.0072
Further Details:      
 
Domain Number 4 Region: 676-788
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000157
Family Spermadhesin, CUB domain 0.0064
Further Details:      
 
Domain Number 5 Region: 793-855
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000837
Family Spermadhesin, CUB domain 0.0079
Further Details:      
 
Domain Number 6 Region: 403-440
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000298
Family EGF-type module 0.013
Further Details:      
 
Domain Number 7 Region: 140-174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000139
Family EGF-type module 0.016
Further Details:      
 
Domain Number 8 Region: 363-398
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000339
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 9 Region: 183-303
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000785
Family Growth factor receptor domain 0.016
Further Details:      
 
Weak hits

Sequence:  FBpp0137516
Domain Number - Region: 319-350
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00268
Family EGF-type module 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0137516   Gene: FBgn0111176   Transcript: FBtr0139024
Sequence length 861
Comment type=protein; loc=scaffold_4690:join(5651509..5651684,5651873..5652056,5652278..5653030,5653088..5653840,5653907..5654626); ID=FBpp0137516; name=Dere\GG18970-PA; parent=FBgn0111176,FBtr0139024; dbxref=FlyBase:FBpp0137516,FlyBase_Annotation_IDs:GG18970-PA,GB_protein:EDV46241,REFSEQ:XP_001977314,FlyMine:FBpp0137516; MD5=a916ec4c4443571102e22396c8810ef5; length=861; release=r1.3; species=Dere;
Sequence
MELLLATNGSKKQSGGKDEWNTADDVVDVRELAERLADINRRAFGANGLSEMLGQQRNRT
RGSMALMRRLQKRLRAVESQVDRMKTQLEVNNCASGPCVNGGTCYNTYTGFRCQCRSAFE
GTKCEVDVNECALYEGTDLGCQNGGQCQNQFGSYSCLCQPGWHGMHCTQRKADCSQASAW
EMCGHGSCVPSADAAGYRCICEPGWKTNGLTPICGEDVDECSDSAGHKPCSTNCINLPGS
FTCAPCPAGLTGNGVSCRDLDECQTNNGGCSLRPKVDCINTYGSYHCGECPLGWIGDGRK
CERSTQGVDNQAGQAPLACPAGNNPCYPTASCFLISGTITCRCPTGMVGTGYAPNGCING
TTTNCVGNPCLNNGICLDAGPLNFTCLCPTGFRPPICEPQPGPCDQQPCKNGGRCRPTTS
GDLFVCQCLPGYRGRLCDTRFSSCNGMLSAQSGRLRYPPEGTGYEHNAQCAWVIRTSESL
VVNVTFNSFDVEDSTECRFDWLQINDGRSAAAQIIGRYCGNHLPHGGNIISSGNQLYLWF
RSDNSTAREGFDLTWNSRQPQCGGRLNFETHGTLASPGSPGNYPKNRDCRWQLVAPTTKR
IKLTFFSLQLEQHENCNFDYVLIKDSVSGRELAKYCTSETPAPLLLPTHLAEIHFHSDAE
GSDTGFQLHYSVEERVPGCGGVYTAKEDTIFETSAANSEPEGVSCEYEIHLAVGELIDIK
IERLELDPLDCLELLDITDEGVSILQEKICGTDAARLNPPAFTSQFHRLKIKFYARAGSF
KLNYRMACTLKLDNDHGNITSPGYPNLTRSDRVCTYTIMTAANTVISLKRIDFQLTSGET
DDEGNDECLTTSLRVSSAPYT
Download sequence
Identical sequences FBpp0137516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]