SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0137818 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0137818
Domain Number 1 Region: 372-395
Classification Level Classification E-value
Superfamily DPY module 0.0000301
Family DPY module 0.0022
Further Details:      
 
Weak hits

Sequence:  FBpp0137818
Domain Number - Region: 329-365
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00469
Family EGF-type module 0.033
Further Details:      
 
Domain Number - Region: 104-127
Classification Level Classification E-value
Superfamily DPY module 0.00706
Family DPY module 0.0046
Further Details:      
 
Domain Number - Region: 66-97
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0218
Family EGF-type module 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0137818   Gene: FBgn0111476   Transcript: FBtr0139326
Sequence length 441
Comment type=protein; loc=scaffold_4690:join(10170237..10170239,10171869..10172043,10172314..10172552,10172645..10172726,10175625..10176241,10176494..10176703); ID=FBpp0137818; name=Dere\GG19272-PA; parent=FBgn0111476,FBtr0139326; dbxref=FlyBase:FBpp0137818,FlyBase_Annotation_IDs:GG19272-PA,GB_protein:EDV46780,REFSEQ:XP_001977853,FlyMine:FBpp0137818; MD5=decaa3fde3d7874fae369691de742c83; length=441; release=r1.3; species=Dere;
Sequence
MQQLLVVALVAVAIASVPQLAAGKKVGKRCVNCTYRTYYTYGDGRSLQRVVYSDPGYTRA
QSYSSGCSGNPCGVNAVCQEASGGRPVCSCPPGFSGNPLTHCNRGECLDNVDCRGNLQCK
DNRCVNPCVGACGIGSNCDARNHVAVCSCPAGYNGDPYHVCHLNDPEEQCHPSPCGVNTK
CEIINGVPTCSCVHGYVGNPLSGCRHECDHDGDCNSRDMCSSNFKCVPACGQCGTGATCR
TVSNHRAVCECPKGYIGSPYTECRPECYGDVDCPAGRPACFYGICKNTCEGACGIGADCN
LRGLTPVCSCPRDMTGDPFVRCRPFTKEDLCDPNPCGTNAICVPGHDNTGRERPVCNCLP
GHTGNPLSHCTRGECLSNNECPDHRACINYQCIDPCIGKCATGASCEPKAHLAVCRCPQG
QSGDALVSCRQTRTFPVAKYH
Download sequence
Identical sequences B3NWG0
FBpp0137818 XP_001977853.1.56816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]