SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0138228 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0138228
Domain Number 1 Region: 177-418
Classification Level Classification E-value
Superfamily vWA-like 1.05e-81
Family Integrin A (or I) domain 0.000000544
Further Details:      
 
Domain Number 2 Region: 402-506
Classification Level Classification E-value
Superfamily Integrin domains 5.75e-23
Family Integrin domains 0.0018
Further Details:      
 
Domain Number 3 Region: 687-770
Classification Level Classification E-value
Superfamily Integrin beta tail domain 1.57e-17
Family Integrin beta tail domain 0.001
Further Details:      
 
Domain Number 4 Region: 597-637
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000123
Family Integrin beta EGF-like domains 0.0074
Further Details:      
 
Domain Number 5 Region: 37-85
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000225
Family Plexin repeat 0.0053
Further Details:      
 
Weak hits

Sequence:  FBpp0138228
Domain Number - Region: 642-685
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000977
Family Integrin beta EGF-like domains 0.0069
Further Details:      
 
Domain Number - Region: 518-544
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0307
Family Integrin beta EGF-like domains 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0138228   Gene: FBgn0111884   Transcript: FBtr0139736
Sequence length 843
Comment type=protein; loc=scaffold_4690:join(16866956..16867448,16867520..16867748,16868367..16868451,16870275..16870709,16870771..16871994,16872068..16872133); ID=FBpp0138228; name=Dere\GG19682-PA; parent=FBgn0111884,FBtr0139736; dbxref=FlyBase:FBpp0138228,FlyBase_Annotation_IDs:GG19682-PA,GB_protein:EDV47532,REFSEQ:XP_001978605,FlyMine:FBpp0138228; MD5=ead520b8c4bd3110b63236358cacfbf7; length=843; release=r1.3; species=Dere;
Sequence
MILERNRRSQLALLLIALLAAIAGQTEAQKAAKQTAVSTCASKEKCHTCIQTEGCAWCMQ
PDFKGQSRCYQNTSLLCPEEFAYSPITLEEILVNNKLTNENKVAGGGGYSMSGESSNTWS
SSYSESSSSSSSSSSSLSGSNYEFRSAGEIVQIQPQSIRLALRVNEKHNIKIRYSQAEGY
PVDLYYLMDLSKSMQDDKDKLSTLGDKLSETMKRITNNFHLGFGSFVDKVLMPYVSTIPK
KLEHPCEDCKAPYGYHNHMPLNNNTESFSNEVKNATVSGNLDAPEGGFDAIMQAIACRSQ
IGWRQQARRLLVFSTDAGFHYAGDGKLGGVIAPNDGECHLNEEGGYTHSTLQDYPSISQI
NQKVKDNAINIIFAVTSNQLSVYEKLVEHIQGASAAKLDNDSSNVVELVKEEYRKISSSV
EMKDNATGDVKITYYSSCLSNGPELQTSKCDNLKEGQQVSFTAQIQLLKCPEDPRDWTQT
IYISPVGINEVMQIQLNMLCSCPCEQQGSTGYQEQASSCSSHGTSMCGICNCDDSYFGNK
CECSATDLTSKFANDTSCRADSTSTTDCSGRGNCVCGACECHKRLNHAEIISGKHCECDN
FSCERNRNQLCSGPDHGTCECGRCKCKPGWTGANCGCQESNDTCMPPEGGEVCSGHGTCK
CGVCKCTVTDQGRFSGRHCEKCPTCSGRCQELKDCVQCQMYKTGELKNGDDCARNCTQFV
PVGVEKVEIDETKDEQMCTFFDEDDCKFMFKYSEQGELHVFAQENKECPPKVFMLGIVLG
VIAAIVLVGLAVLLLWKLLTTIHDRREFARFEKERRNAKWDTGENPIYKQATSTFKNPMY
AGK
Download sequence
Identical sequences B3NY11
XP_001978605.1.56816 FBpp0138228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]