SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0138464 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0138464
Domain Number 1 Region: 4-287
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 2.49e-103
Family Inorganic pyrophosphatase 0.000000029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0138464   Gene: FBgn0112118   Transcript: FBtr0139972
Sequence length 290
Comment type=protein; loc=scaffold_4845:complement(21818562..21818593,21818907..21819016,21819074..21819225,21819283..21819678,21819745..21819863,21820299..21820362); ID=FBpp0138464; name=Dere\GG19918-PA; parent=FBgn0112118,FBtr0139972; dbxref=FlyBase:FBpp0138464,FlyBase_Annotation_IDs:GG19918-PA,GB_protein:EDV57023,REFSEQ:XP_001976623,FlyMine:FBpp0138464; MD5=d5bfee9ad63f9757ae771964a105df7a; length=290; release=r1.3; species=Dere;
Sequence
MALYETVEKGAKNSPSYSLYFKNKCGNVISPMHDIPLYANEQNTIYNMVVEVPRWTNAKM
EISLKTPMNPIKQDIKKGKLRFVANCFPHKGYIWNYGALPQTWENPDHIEPSTGCKGDND
PIDVIEIGYRVAKRGDVLKVKVLGTIALIDEGETDWKIIAIDVNDPLASKVNDIADVDQY
FPGLLRATVEWFKIYKIPDGKPENQFAFNGDAKNADFANTIIAETHKFWQNLVHQSPATG
SISTTNITNRNSEHIIPKEEAEKILAEAPDGGQVEEVADTVDTWHFIHLK
Download sequence
Identical sequences FBpp0138464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]