SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0138688 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0138688
Domain Number 1 Region: 1546-1757
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.68e-41
Family Laminin G-like module 0.00066
Further Details:      
 
Domain Number 2 Region: 575-689
Classification Level Classification E-value
Superfamily Cadherin-like 1.3e-30
Family Cadherin 0.00084
Further Details:      
 
Domain Number 3 Region: 995-1108
Classification Level Classification E-value
Superfamily Cadherin-like 4.14e-30
Family Cadherin 0.00063
Further Details:      
 
Domain Number 4 Region: 894-1000
Classification Level Classification E-value
Superfamily Cadherin-like 8.25e-29
Family Cadherin 0.00085
Further Details:      
 
Domain Number 5 Region: 1780-1963
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.88e-28
Family Laminin G-like module 0.0095
Further Details:      
 
Domain Number 6 Region: 683-787
Classification Level Classification E-value
Superfamily Cadherin-like 4.58e-28
Family Cadherin 0.0019
Further Details:      
 
Domain Number 7 Region: 782-892
Classification Level Classification E-value
Superfamily Cadherin-like 4.06e-25
Family Cadherin 0.0015
Further Details:      
 
Domain Number 8 Region: 458-573
Classification Level Classification E-value
Superfamily Cadherin-like 4.58e-23
Family Cadherin 0.0011
Further Details:      
 
Domain Number 9 Region: 356-457
Classification Level Classification E-value
Superfamily Cadherin-like 3.27e-22
Family Cadherin 0.0037
Further Details:      
 
Domain Number 10 Region: 1101-1221
Classification Level Classification E-value
Superfamily Cadherin-like 8.14e-21
Family Cadherin 0.0018
Further Details:      
 
Domain Number 11 Region: 1213-1300
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000012
Family Cadherin 0.013
Further Details:      
 
Domain Number 12 Region: 1482-1522
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000027
Family EGF-type module 0.01
Further Details:      
 
Domain Number 13 Region: 2095-2135
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000226
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 14 Region: 2782-3083
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000458
Family Rhodopsin-like 0.03
Further Details:      
 
Weak hits

Sequence:  FBpp0138688
Domain Number - Region: 28-111
Classification Level Classification E-value
Superfamily Cadherin-like 0.000443
Family Cadherin 0.017
Further Details:      
 
Domain Number - Region: 2145-2198
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.0915
Family Hormone receptor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0138688   Gene: FBgn0112336   Transcript: FBtr0140196
Sequence length 3582
Comment type=protein; loc=scaffold_4845:complement(19171756..19171786,19172385..19174250,19174337..19181666,19181766..19183287); ID=FBpp0138688; name=Dere\GG20142-PA; parent=FBgn0112336,FBtr0140196; dbxref=FlyBase:FBpp0138688,FlyBase_Annotation_IDs:GG20142-PA,GB_protein:EDV56582,REFSEQ:XP_001976182,FlyMine:FBpp0138688; MD5=271629119df5ba832f32eb671844926c; length=3582; release=r1.3; species=Dere;
Sequence
MQTREVLQRPLGLLLVLLVLLLQSSLIRSYLIIVHEDTPPGTVIFNASVYKLGSERHYKI
NAHKSANFVHHLVAVNHKDGQIQLRKALKCDGIYYPNLFTFYVDSTSNRLRSIDYYSLPV
RIFVSGHSCNEDRRIEQELHHHHYEEEDNTGYSKRRRRRSVQELSQLNGNQLEQVFRQNS
TEFRAGDLIFGDSFDNEMRHRILSRKRRAVGSPDPLHLQPALHRRISDAKQWISETYASY
AIHTTDKWNQICLRRSQFINSLNAFLPRSVCQHCKVSFLDVNDERFAIEHQSRDLVASRD
VCIAESMWKVSITFNIRCDRRDIVDSDHRLKIVYHHQEFNDTDIARRVRRELRNQSPYFE
QALYVASVLEEQPAGAAVTTVRARDPEDSPVVYSMVSLLDSRSQSLFKVDSRTGVVTTSA
SLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVG
STVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRET
SDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGAED
NTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIR
AQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGA
NAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSV
VITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRF
AITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINITDANNFAPIFENA
PYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIV
TNAALDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPSFKSPLYQASILEDA
LVGTSVIQVAASDPDVGLNGRIKYLLSDRDVEDGSFVIDPTSGTIRTNKGLDRESVAVFH
LTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDP
DEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRAASPPL
RNDAHIEILVTDVNDNAPVLRDFQVIFNNFRDHFPSGEIGRIPAFDADVSDKLHYRILSG
NNANLLRLNSSSGGLVLSPQLNTNVPKFATMEVSVSDGINEAKAIMQLSVRLITEDMLFN
SVTVRLNEMTEEAFLSPLLNFFLDGLAAIIPCPKEHIFVFSIQDDTDVSSRILNVSFSAR
RPDVSHEEFYTPQYLQERVYLNRAILARLATVEVLPFDDNLCVREPCLNFEECLTVLKFG
NASEFIHSDTVLFRPIYPVNTFACSCPEGFTGSKEHYLCDTEVDLCYSDPCQNGGTCVRR
EGGYTCVCPSTHTGQNCETGVGHLRPCPSETCEGGLSCLGNYPSSQPPPYTATCELRARA
FGRNSFLTFESLKQRHRFNLKLRFATVQENGLLLYNGRYNELHDFIALEIHEGHVSFSFS
LGDHSERISVMQEAKVSDGKWHQVEVVYLNRSVTLVLDDCDTAIALSGQLGDRWSCANRT
TLKLDKRCSLLTETCHRFLDLTGPLQVGGLPRIPAHFPVTNRDFVGCISDLRIDDRFVDL
NSYVADNGTLAGCPQKAPLCQSEPCFNGGTCREGWGTYSCECPEGYAGNSCQDNIPAPWR
FSGDGSLSFNPLLRPIQLPWTTSFSLRTRQKEAFLLQIQIGQNSSAAVCLRQGVLYYIFD
GEPMYLAGAFLSDGEWHRVEIRWQQGSEIHFSVDYGQRSGSVPMSQKVQGLYVGKIVMGS
PDGSIGTVPEAAPFEGCIQDVRIGAGQSVLSRPTIRENVEDGCESRAQCPDHCPNHSSCQ
SSWDLSNCECDAGYVGAECAPICTVRPCASGVCQANTSLPRGYDCECNSSSRHGDYCEKE
LQQPCPGGWWGERVCGPCRCDLAQGYHPDCNKTTGQCYCKTNHYQPPNETACLSCDCYSI
GSFSGACNPLTGQCECREGVIGRRCDSCSNPYAEVTLSGCEVVYDACPRSFAGGVWWPRT
PLGGVAIEGCPPPARGKGQRTCDAQSGSWNTPDMYNCTSEPFVELRRQLSQLEKLELELN
SFVAIKMAEQLRKACEAVDRRGASKDQKTLGNGRPSRRYKMESSFLLSNGGNVWSHELEM
DYLSDELKFTHDRLYGADLLVTEGLLQELINYELMQSGLNLSHSQDKYFIKNLVDVASVI
LDRKYEAEWRRATELIQRGPDDLVDAFNKYLVVLARSQHDTYTSPFEIVQPNMVLGLDIV
TTESLFGYEPEQLSEYHRSKYLKPNAFTTESVVLPDTSGFLQHSARQRPVISFPKYNNYI
LDRRKFDQHTKVLVPLEMLGITPPESDEISQSGRRGGSHDHRAIVAYAQYKDVGQLLPDL
YDETITRRWGVDVELATPILSLQILVPSMEREREQETQHLEVPSRKIFSSSSPSSSSAGS
TEQQFVEVFDVPKAPTSSSEQQIEDIRITAHEIPPPVSSVEQQEASSGEDGEEREPHIHL
NLDDIEFHGNSGEEVISPDSPEMLNPNYEGVSSTGSDEQQKGENEAVYRDRRLVKRQVEV
TYPSEQVQQSEQVVYRSLGSPHLAQPIKLQMWLDVDSARFGPRSNPQCVRWNSFTNQWTR
LGCQTEIPDFDGDFNPASQPAILVNCSCTHISSYAVIVDVIDPEDIPEPSLLVQITSYSA
FLVSLPLLLGVLLALALLRGQQTNSNTIHQNIVLCVFCAELLFFVGMQSRRQLLESEFPC
KLTAICLHYFWLAAFAWTTVDCVHLYRMLTEMRDINHGPMGFYFAMGYGAPAIVVGLSVG
VRAHEYGNSLFCWLSVYEPVVWWLVGPIAGMSVVNLLILFVSVKAAFTLKDHVLGFGNLR
TLLWLSVVSLPLMGVMWVLAVLAASEHSQLLSLLLSGVVLLHALFCLIGYCIINKRVREN
LQRTCLRCMGRKVPLLDSSMVVSNSSHNVNAAARPSNFLTGGYDTTTRRNIGISASSTTS
RSTAKTSSSPYSDGQLRQTSTSTSNYNSASDAPSFLRGFESSTTGRSRGGEEKPSRRQRK
DSDSGSETDGRSLELASSHSSDDDESRTARSSGTHRSTAVSSTPAYLPNITEHVQATTPP
ELNVVQSPQLFPSVNKPVYAPRWSSQLPDAYLQSPPNIGRWSQDTGSDNEHVHGQAKMTI
SPNPLPNPDLTDTSYLQQHHNKINMPPSILENIRDAREGYEDSLYGRRGEYPDKYGSYKP
PSHYGSEKDYPGGGSGSQTIGHMRSFHPDAAYLSDNIYDKQRTLGSGYLGAKSESPYLSK
DRITPDIYGSRDGHYSLKRQPAYATDSLHSVHSLLKNDYHQQQQQQQQQQHHHLQDRLSE
GSDKNGYHFPYTAEEDHLPARKLSHTQPPSLHGSQLMQPPGVALVNDVNNPGLLGRHTLN
GGSRHSSRASSPPSSMVAPMQPLGPLTSITDTDWSWERLKHI
Download sequence
Identical sequences FBpp0138688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]