SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0139108 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0139108
Domain Number 1 Region: 588-775
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.16e-42
Family Laminin G-like module 0.00036
Further Details:      
 
Domain Number 2 Region: 1182-1352
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.36e-34
Family Laminin G-like module 0.00029
Further Details:      
 
Domain Number 3 Region: 369-556
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-31
Family Laminin G-like module 0.0025
Further Details:      
 
Weak hits

Sequence:  FBpp0139108
Domain Number - Region: 51-87
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000239
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0139108   Gene: FBgn0112752   Transcript: FBtr0140616
Sequence length 1365
Comment type=protein; loc=scaffold_4845:complement(13921957..13922111,13922173..13922276,13925477..13925578,13925640..13927063,13927128..13927280,13927342..13927417,13927489..13927706,13927768..13927904,13927961..13928150,13928209..13928555,13928623..13928741,13928972..13929794,13930441..13930557,13932175..13932307); ID=FBpp0139108; name=Dere\GG20562-PA; parent=FBgn0112752,FBtr0140616; dbxref=FlyBase:FBpp0139108,FlyBase_Annotation_IDs:GG20562-PA,GB_protein:EDV55828,REFSEQ:XP_001975428,FlyMine:FBpp0139108; MD5=b2f8a9cb80064041bac7e5a47081159a; length=1365; release=r1.3; species=Dere;
Sequence
MSTSKHHHHHCRVVCVWLLLVLSSLSSASIAVGAIPEPEEAAFQGHCGHTSPCEQLCYEI
HDGMYECDCIEGYELNKNGYSCQVINATSNSLDGRGKSDEDVLYQKGASFSAKLANDDGG
KAMAKSTFALSASQSASPAGNENAEDESGSEGDSYDYGELEDSNSETQEQKQQSLNLQQQ
QQQQQQQKVNSNDYYISAESINFNSESEGQEQDVADFKAASTARPVSMPPTPSRSTPRAT
ASTTTRTTTTRRSPTRAPRNRVDVDYGEGDASDDYSYGYKSDMSVYDDVNNNQLNLRRNS
KSQTYQQTSNTNTAKNRRKYPNATSNKVQMHITRESNRLENISAAEPAAVGAAMTTDRST
PTCSLDCGSDGICALEATAASSRCLCPFGKTGTGCQEDIRAHVPRFAKRSWLAFPALHGA
YKHVQLRIEFRPESFDGIILLSGERDDLTGDFMALLLNKGFVEFWFDCGSGVGSVRSRET
ILLNEWNSVIIYRHRWDAWLVLNHGTKVQGRSNGLFSRITFREPVFLGGIGNITGLAKRL
PLAEGFAGCIRRFVANEHDYKFTEHPLGDVINGFDIQDCSTDKCVRYPCQHGGKCLPSDQ
GAICLCPIGFVGDLCEIRMDLQVPAFNGSSFLRYAPLGDSALIWLELKVTLKPEQADGLI
LYSGPEHRGDFIALYLNDGFVEFAFDLGSGPALVRSEHSLSLGQWHTIKISRTARLAVLK
VDKHQEVLTISSNGFWHLSLDQNLFVGGVNHVDRLPLDLKYKPFFVGCIQRIDINGHSLG
IVAEALGGSNIGNCPHACVARPCGPLAECVPQMESYECRCSIHNERCNKAAEVPPEQLPE
LALHKSKVLETKDNGEAAKKVSGLAHKKHSKKHRNLHKPTPATSTSTSTTTSTTSTTSTT
TEAPPERSEEATAGALSNEEIEDDIIFRLVQQQQQQKELKKQHQPTTTTAPATSTSAGPP
KAKPRLSGKHHASKHEHHQKPNAAFARKLSRLPTHYESFQTNPDSDILTFEDNNDWVTSL
QQQEYGDAMAASQMPLAFEDGNPGNPKSSDNNEDDENAFVFDESLFDASDGTEEYQRKQL
AQDMKRIMSNSNTHSSHKKAEVQFPSQTSQEGGAANEDTSQYSDDYNDDELLTPVMQGGE
EVQPEQHASSTPQTHTDWSLLKKFDLSAEHQSQVQGVRKNFGACFAGSDSYFHYNDADTM
SQVISYSIDLNLRIKTHSENGVILWTGRQGTTEEHDDYLSLGIEEGYLHFRYDLGSGEVD
IRFNGTKVSDGLWHRVRAIRNSQEGYLEVDGRKTVTLRAPGKLRQLNTDTGLYVGGMPDV
GYFTHQRYFSGIVGCISEIVLAGEMKLNFDPNTLGTEHNVETGLL
Download sequence
Identical sequences B3NPY1
XP_001975428.1.56816 XP_015011699.1.56816 FBpp0139108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]