SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0139817 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0139817
Domain Number 1 Region: 130-373
Classification Level Classification E-value
Superfamily vWA-like 3.34e-69
Family Integrin A (or I) domain 0.00000154
Further Details:      
 
Domain Number 2 Region: 32-80
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000361
Family Plexin repeat 0.0025
Further Details:      
 
Domain Number 3 Region: 590-626
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000271
Family Integrin beta EGF-like domains 0.044
Further Details:      
 
Domain Number 4 Region: 527-555
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000949
Family Integrin beta EGF-like domains 0.025
Further Details:      
 
Weak hits

Sequence:  FBpp0139817
Domain Number - Region: 386-463
Classification Level Classification E-value
Superfamily Integrin domains 0.000136
Family Integrin domains 0.011
Further Details:      
 
Domain Number - Region: 473-500
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00246
Family Integrin beta EGF-like domains 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0139817   Gene: FBgn0113450   Transcript: FBtr0141325
Sequence length 799
Comment type=protein; loc=scaffold_4845:complement(3434227..3435327,3435386..3435581,3435656..3436406,3437730..3437916,3438041..3438117,3438174..3438261); ID=FBpp0139817; name=Dere\GG21271-PA; parent=FBgn0113450,FBtr0141325; dbxref=FlyBase:FBpp0139817,FlyBase_Annotation_IDs:GG21271-PA,GB_protein:EDV54482,REFSEQ:XP_001974082,FlyMine:FBpp0139817; MD5=a2b24f580933b986454603015b10b370; length=799; release=r1.3; species=Dere;
Sequence
MTSLREKAFLWICLFFLVGRISNSDADSIDDQCMHADSCERCLSAHMECAWCTDKKYKDA
YRCLSRRLLLTNNCSETYIYENQPVLDVLQDKPLKDYETRDQAVQVTPQRAYLRLVKENT
QRIKLSYRAARNNPLDLYVLMDLTWTMRDDKETLEELGAQLSQTLKNLTANYRLGFGSFA
DKPTVPMILPQHRENPCAGEQAKCEPTYGYRHQLSLTDDIPAFTAAVANSKITGNLDNLE
GGLDALMQVIVCTKEIGWKEQARKVVILVTDGFMHLAGDGLLAGIIQRNDKQCHLNKAGE
YTGSLDYDYPSLEEIYRELLRRKINVIFAVTQEVVSSYMELSALMKEISYVDILSADSSN
ILELIKKSFASLIKRTQFADNSPDFIDMVYYTDCGGQFPSLQKRNYCNNVSLGKQIDFYV
DVTLKKHPDNQVYTHKIRVEETSLSEFMDLDVELQRPCPCQDTPDPRKEEGRSLCDNNGY
LYCGMCSCDDGWTGTYCKCPTDATNVTSNEALLQKCRQTLSDKSTSELVCSNHGDCDCGK
CLCDPGYKGTFCECRECLDCDEKLADCSCGQCVCKYGWSGTKCNCDGATVACVGPTGEIC
SERGTCECEECQCEKPYLGKFCEIDPEKDNKLCLFYEPCVTCLIKQKQGMGACENLTHIC
SSLDRQETYSYNFVHELDPEQNQCLVRMVNKHGIQCDSFFAYQVIDHSNLLIIQAVDCEP
TDKVALLGYISAFTLLVGLLTILLVLWYIRAKDAREFARFEEDQKNSVRQENPLYRDPVG
RYEVPKALSVKYDENPFAS
Download sequence
Identical sequences B3NKV9
XP_001974082.1.56816 FBpp0139817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]