SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0140166 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0140166
Domain Number 1 Region: 78-128
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000419
Family EGF-type module 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0140166   Gene: FBgn0113798   Transcript: FBtr0141674
Sequence length 230
Comment type=protein; loc=scaffold_4845:4720770..4721462; ID=FBpp0140166; name=Dere\GG21620-PA; parent=FBgn0113798,FBtr0141674; dbxref=FlyBase:FBpp0140166,FlyBase_Annotation_IDs:GG21620-PA,GB_protein:EDV54628,REFSEQ:XP_001974228,FlyMine:FBpp0140166; MD5=55a57b9fae55de4fba5cd2f59d3e1e0d; length=230; release=r1.3; species=Dere;
Sequence
MSVQHGVVALVLIGCLAHPSYVEACSSRTVPKPRSSISSSMSGTALPPTQAPVTSSTTMR
TTTTTTPRPNITFPTYKCPETFDAWYCLNDAHCFAVKIADLPVYSCECAIGFMGQRCEYK
EIDNTYLPKRPRPMLEKASIASGAMCALVFMLFVCLAFYLRFEQRAAKKAFELEQELQQE
YDDDESQCECCRNRCCPDGQEPVILERKLPYHMRLEHALMSFAIRRSNKL
Download sequence
Identical sequences FBpp0140166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]