SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0140802 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0140802
Domain Number 1 Region: 1184-1478
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.76e-80
Family Protein kinases, catalytic subunit 0.000000695
Further Details:      
 
Domain Number 2 Region: 501-689
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.28e-27
Family MAM domain 0.012
Further Details:      
 
Domain Number 3 Region: 285-448
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000411
Family MAM domain 0.0031
Further Details:      
 
Weak hits

Sequence:  FBpp0140802
Domain Number - Region: 457-494
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00314
Family LDL receptor-like module 0.0043
Further Details:      
 
Domain Number - Region: 1055-1089
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0662
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0140802   Gene: FBgn0114428   Transcript: FBtr0142310
Sequence length 1701
Comment type=protein; loc=scaffold_4845:join(13338004..13338798,13338867..13339560,13339626..13340118,13340186..13340373,13340440..13340617,13340683..13341716,13341774..13341981,13342048..13343563); ID=FBpp0140802; name=Dere\GG22256-PA; parent=FBgn0114428,FBtr0142310; dbxref=FlyBase:FBpp0140802,FlyBase_Annotation_IDs:GG22256-PA,GB_protein:EDV55729,REFSEQ:XP_001975329,FlyMine:FBpp0140802; MD5=c902ac22e8af8c89dda8291f5914cc02; length=1701; release=r1.3; species=Dere;
Sequence
MPQLRQLVVVLAILSLLVNPSFTQRPLIMNHTFSSLPMSQHPSFNSWPGASGGKQLRNGR
LHEQPLPLPQPTLPVATQYEDYEAAPPGSRRDNKRRLAQMAQRPGSGNGGRRGMESLRKE
LMNPSVGGPGGGISGGGAGYPSYSATSSIGRIDGLGQGIGSADRYGALYDQLRQPSGMAA
MTAGPLGGPYSTRFPPLYAGVDDQPKRSNRKNSISELYKLKKALNQADEPAGGVTHGNFE
GDPQPSSADPLQEIKDRIRDTSPNANTYAPHTDATPSSEYEYELGVKCNFETACSWTWGN
YSDGFQVITGTELSKRNLTGLLPGPAADSIDDANGHFLYARVNPSSRPLNLTSPEFSTTM
EKCFLEVYMHQSDMSHGLSRVVVEPLHTAESSWVPAEILGDNVRQWTRKVYRLGRVSRDF
RIVFEVVPDLRVGQKGHVALDNLRMVNCFPEGTKSEKCSTSQVKCTASKVPVCIHLPRIC
DITRDCDEAEDEQQSCDKIPYGGRCDFEEDWCGWRDSGKTTLTWSRHTGSSPTHDTGPDG
DHTMQHLQNNTSGYYMLVNMNQHMNNSEKNSIIGFASNAIMVSKTFNPPPSVHGNPDSAY
RNSCVVRFFIHQFGKNPGSINLSVVEMKEKENITTTLWWSTKNQGSEWLRGDYVLPNITS
KYYLQFEARMGMRIYSDVAVDDFSLSPECFGLNIPEDQLGGYNYWDVRQNLKSPTYKDFE
YTNYLELTSCDTRGMIGPSQAQCEAAYKEQNKTHVLREVHVVEDQSSYKGMQKWKVPHEG
HYTIIAKGASGGLGSGGVGSSRGSVAVAILELHKHEELYFLVGQQGENACIKSMGVLKEA
GCGTDHDLDLAQYSFRSKQDMVKNIYIENGAGGGGGGSYVFLLNQAKNEAVPLLVAGGGG
GLGIGQYIDEDFQHGQKAKPLQAPESGQINGEPLNKKTAGPGGGWRAKEDQALSPTYGAA
LLQGGRGGHSCYVELADNGTSVHRHGQGGFGGGGGGCNTGGGGGGYAGGDVYLTESNGEG
GSSYISPSRSLREISEIHAGASSGPGAIIIIPAIEGCGCDYRCVALDEFRSKVRCICPDG
WSLKRDNHTACEIREEAGKSSFQYLVSILMISLAVLFICIGALIFMLYNRYQRKKQSKKR
HKMLVEQDLQLTRLRNNIDDSNLNNFNPNYGCDGILNGHIDVNSLPQVARDSLQLVNALG
KGAFGEVYMALYRHRDGDAVEMGVAVKTLREDPKREKEEDFLKEAAIMAKFNHPNMVHLI
GVCFDRQPYYIVLELLAGGDLQKFLRENRNTPERPSLLTMKDLLFCALDVAKGCRYMESK
RFIHRDIAARNCLLSSKGPGRVVKIADFGMSRDIYRSDYYRKGGKAMLPIKWMPPEAFLD
GIFTSKTDVWSFGILLWEVFSLGRSPYPGQHNTQVMELVVRGGRLGSPTECPVSIYKVMA
DCWNPTPEDRPTFITLLEHLTACTQDASIMNAPLPNILGPTASERDDTVIRPPNGEEFCL
AVPDYLVPLPPGGSNNPSVASGSGYVPESQRQQISSCTPPAVTSPAAPHPRPVENLATAN
GDCWETSFILPNSKVEPPVAGSGHDVPLAGGAEAKLISLDTPQPTPTTIQPPLSFASQLD
GITLDPSALTKSLPNGSTKQSYANVQVKNEVEGKVVNGVVGNGTVMNGDVSTGSGGADSP
FTIQGYAERYKDNNNHSEISC
Download sequence
Identical sequences B3NPG2
FBpp0140802 XP_001975329.1.56816 XP_015012294.1.56816 XP_015012295.1.56816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]