SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0140871 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0140871
Domain Number 1 Region: 76-256,335-494
Classification Level Classification E-value
Superfamily L domain-like 4.37e-58
Family Ngr ectodomain-like 0.0052
Further Details:      
 
Domain Number 2 Region: 542-683,739-889
Classification Level Classification E-value
Superfamily L domain-like 4.76e-58
Family Ngr ectodomain-like 0.00000031
Further Details:      
 
Domain Number 3 Region: 1161-1349
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.17e-39
Family Laminin G-like module 0.0033
Further Details:      
 
Domain Number 4 Region: 1088-1134
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000259
Family EGF-type module 0.01
Further Details:      
 
Domain Number 5 Region: 971-1014
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000132
Family EGF-type module 0.01
Further Details:      
 
Domain Number 6 Region: 928-970
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000168
Family EGF-type module 0.007
Further Details:      
 
Domain Number 7 Region: 1049-1086
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000107
Family EGF-type module 0.011
Further Details:      
 
Domain Number 8 Region: 1009-1053
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000167
Family EGF-type module 0.01
Further Details:      
 
Domain Number 9 Region: 1376-1417
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000317
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0140871   Gene: FBgn0114497   Transcript: FBtr0142379
Sequence length 1504
Comment type=protein; loc=scaffold_4845:join(14080102..14080415,14084395..14084466,14084535..14084606,14085029..14085100,14085198..14085341,14086085..14086320,14087742..14087883,14087963..14088106,14089153..14089368,14090734..14090891,14090961..14091114,14091213..14091431,14091703..14091774,14093253..14093621,14093691..14093762,14094517..14094660,14094725..14096249,14096311..14096470,14097092..14097234,14097308..14097394); ID=FBpp0140871; name=Dere\GG22325-PA; parent=FBgn0114497,FBtr0142379; dbxref=FlyBase:FBpp0140871,FlyBase_Annotation_IDs:GG22325-PA,GB_protein:EDV55857,REFSEQ:XP_001975457,FlyMine:FBpp0140871; MD5=9e7a7fd9dbaf8ac90447300e73dc0a3e; length=1504; release=r1.3; species=Dere;
Sequence
MAALSRTTLMPPPFRLQLRLLILPILLLLPHDAVHAEPYSGGFGSSAVSSGGLGSVGIHI
PGGGVGVITEARCPRVCSCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDF
QRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAIPENLVTSSASLLRLDIS
NNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLTSLPHNIF
GGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRLAPYTRCQSPSQLKGQNVADLHDQEF
KCSGLTEHAPMECGAENSCPHPCRCADGIVDCREKSLTSVPVTLPDDTTELRLEQNFITE
LPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSL
QLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFIC
DCNLRWLADYLHKNPIETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSGECRMD
SDCPAMCHCEGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKL
ELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGLHQLKTLNLYDNQISCVMP
GSFEHLNSLTSLNLASNPFNCNCHLAWFAEWLRKKSLNGGAARCGAPSKVRDVQIKDLPH
SEFKCSSENSEGCLGDGYCPPSCTCTGTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQ
IHYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNL
RVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGLKWFSDWIKLDYVEPGIARCA
EPEQMKDKLILSTPSSSFVCRGRVRNDILAKCNACFEQPCQNQAQCVALPQREYQCLCQP
GYHGKHCEFMIDACYGNPCRNNATCTVLEEGRFSCQCAPGYTGARCETNIDDCLGEIKCQ
NNATCIDGVESYKCECQPGFTGEFCDTKIQFCSPEFNPCANGAKCIDHFTHYSCDCQAGF
HGTNCTDNIDDCQNHMCQNGGTCVDGINDYQCRCPDDYTGKYCEGHNMISMMYPQTSPCQ
NHECKHGVCFQPNAQGSDYLCRCHPGYTGKWCEYLTSISFVHNNSFVELEPLRTRPEANV
TIVFSSAEQNGILMYDGQDAHLAVELFNGRIRVSYDVGNHPVSTMYSFEMVADGKYHAVE
LLAIKKNFTLRVDRGLARSIINEGSNDYLKLTTPMFLGGLPVDPAQQAYKNWQIRNLTSF
KGCMKEVWINHKLVDFGNAQRQQKITPGCALLEGEQQEEEDDEQDFMDETPHIKEEPVDP
CLENKCRRGSRCVPNSNTRDGYQCKCKHGQRGRYCDQGEGSTEPPTVTAASTCRKEQVRE
YYTENDCRSRQPLKYAKCVGGCGNQCCAAKIVRRRKVRMVCSNNRKYIKNLDIVRKCGCT
KKCY
Download sequence
Identical sequences FBpp0140871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]