SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0141035 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0141035
Domain Number 1 Region: 411-659
Classification Level Classification E-value
Superfamily YWTD domain 1.15e-49
Family YWTD domain 0.00000425
Further Details:      
 
Domain Number 2 Region: 92-358
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-45
Family YWTD domain 0.0000067
Further Details:      
 
Domain Number 3 Region: 711-970
Classification Level Classification E-value
Superfamily YWTD domain 8.89e-45
Family YWTD domain 0.0000133
Further Details:      
 
Domain Number 4 Region: 1019-1244
Classification Level Classification E-value
Superfamily YWTD domain 1.03e-28
Family YWTD domain 0.00029
Further Details:      
 
Domain Number 5 Region: 363-401,670-706,964-1015
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000706
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 6 Region: 1367-1403
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000275
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 1319-1366
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000288
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 8 Region: 1406-1441
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000157
Family LDL receptor-like module 0.002
Further Details:      
 
Weak hits

Sequence:  FBpp0141035
Domain Number - Region: 1274-1329
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0542
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0141035   Gene: FBgn0114660   Transcript: FBtr0142543
Sequence length 1681
Comment type=protein; loc=scaffold_4845:join(16446580..16446781,16469947..16472936,16472997..16473154,16473217..16473486,16473546..16474170,16474234..16475034); ID=FBpp0141035; name=Dere\GG22489-PA; parent=FBgn0114660,FBtr0142543; dbxref=FlyBase:FBpp0141035,FlyBase_Annotation_IDs:GG22489-PA,GB_protein:EDV56159,REFSEQ:XP_001975759,FlyMine:FBpp0141035; MD5=58483fcb2d5a7c93df9f8285a4280b82; length=1681; release=r1.3; species=Dere;
Sequence
MALEPYTKSAEIEPQLCQVIENNEDVTTKATKCAKCAKSNSGVDWRQMLIGFLLICFGIS
NSWQYKNVHMPSSSSLIASPPASAFVNTPATLLFTTRHDIQVANITRPTGGPQIDVIVRD
LAEAMAIDFYYAKNLVCWTDSGREIIECAQTNSSALQPLLRAPKQTVISTGLDKPEGLAI
DWYTDKIYWTDGEKNRIEVATLDGRYQKVLFWTDLDQPRAVAVVPARKLLIWTDWGEYPK
IERASMDGDPLSRMTLVKEHVFWPNGLAVDLKNELIYWTDGKHHFIDVMRLDGSSRRTIV
NNLKYPFSLTFYDDRLYWTDWQRGSLNALDLQTRELKELIDTPKAPNSVRAWDPSLQPYE
DNPCAHNNGNCSHLCLLATNSQGFSCACPTGVKLISANTCANGSQEMMFIVQRTQISKIS
LDSPDYTIFPLPLGKVKYAIAIDYDPVEEHIYWSDVETYTIKRAHADGSGVTDFVTSEVR
HPDGLALDWLARNLYWTDTVTDRIEVCRLDGTARKVLIYEHLEEPRAIAVAPSLGWMFWS
DWNERKPKVERASLDGSERVVLVSENLGWPNGIALDIEAKAIYWCDGKTDKIEVANMDGS
GRRVVISDNLKHLFGLSILDDYLYWTDWQRRSIDRAHKITGNNRIVVVDQYPDLMGLKVT
RLREVRGQNACAVRNGGCSHLCLNRPRDYVCRCAIDYELANDKRTCVVPAAFLLFSRQEH
IGRISIEYNEGNHNDERIPFKDVRDAHALDVSVAERRIYWTDQKSKCIFRAFLNGSYVQR
IVDSGLIGPDGIAVDWLANNIYWSDAEARRIEVARLDGSSRRVLLWKGVEEPRSLVLEPR
RGYMYWTESPTDSIRRAAMDGSDLQTIVAGANHAAGLTFDQETRRLYWATQSRPAKIESA
DWDGKKRQILVGSDMDEPYAVSLYQDYVYWSDWNTGDIERVHKTTGQNRSLVHSGMTYIT
SLLVFNDKRQTGVNPCKVNNGGCSHLCLAQPGRRGMTCACPTHYQLAKDGVSCIPPRNYI
IFSQRNSFGRLLPNTTDCPNIPLPVSGKNIRAVDYDPITHHIYWIEGRSHSIKRSLANGT
KVSLLANSGQPFDLAIDIIGRLLFWTCSQSNSINVTSFLGESVGVIDTGDSEKPRNIAVH
AMKRLLFWTDVGSHQAIIRARVDGNERVELAYKLEGVTALALDQQSDMIYYAHGKRIDAI
DINGKNKKTLVSMHISQVINIAALGGFVYWLDDKTGVERITVNGERRSAELQRLPQITDI
RAVWTPDPKVLRNHTCMHSRTKCSHICIASGEGIARTRDVCSCPKHLMLLEDKENCGAFP
ACGPDHFTCAAPVSGISDVNKDCIPASWRCDGQKDCPDKSDEVGCPTCRADQFSCQSGEC
IDKSLVCDGTTNCANGHDEADCCKRPGEFQCPINKLCISAALLCDGWENCADGADESSDI
CQQRRMAPATDKRAFMILIGATMITIFSIVYLLQFCRTRIGKSRTEPKDDQATDPLSPST
LSKSQRVSKIASVADAVRMSTLNSRNSMNSYDRNHITGASSSTTNGSSMVAYPINPPPSP
ATRSRRPYRHYKIINQPPPPTPCSTDICDESDSNYTSKSNSNNSNGGATKHSSSSAAACL
QYGYDSEPYPPPPTPRSHYHSDVRIVPESSCPPSPSSRSSTYFSPLPPPPSPVQSPSRGF
T
Download sequence
Identical sequences B3NRK7
XP_001975759.1.56816 XP_015012459.1.56816 FBpp0141035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]