SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0141889 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0141889
Domain Number 1 Region: 3045-3305
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-48
Family YWTD domain 0.00000917
Further Details:      
 
Domain Number 2 Region: 1265-1533
Classification Level Classification E-value
Superfamily YWTD domain 7.46e-46
Family YWTD domain 0.00000264
Further Details:      
 
Domain Number 3 Region: 2204-2472
Classification Level Classification E-value
Superfamily YWTD domain 1.14e-35
Family YWTD domain 0.0000369
Further Details:      
 
Domain Number 4 Region: 3871-4104
Classification Level Classification E-value
Superfamily YWTD domain 1.06e-29
Family YWTD domain 0.00027
Further Details:      
 
Domain Number 5 Region: 1585-1832
Classification Level Classification E-value
Superfamily YWTD domain 6.8e-29
Family YWTD domain 0.00025
Further Details:      
 
Domain Number 6 Region: 1913-2158
Classification Level Classification E-value
Superfamily YWTD domain 5.75e-28
Family YWTD domain 0.00025
Further Details:      
 
Domain Number 7 Region: 543-790
Classification Level Classification E-value
Superfamily YWTD domain 1.31e-27
Family YWTD domain 0.00016
Further Details:      
 
Domain Number 8 Region: 294-458
Classification Level Classification E-value
Superfamily YWTD domain 7.46e-21
Family YWTD domain 0.00037
Further Details:      
 
Domain Number 9 Region: 2957-3035,3299-3360
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.73e-18
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 10 Region: 1161-1273,1526-1578
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.43e-16
Family Growth factor receptor domain 0.0091
Further Details:      
 
Domain Number 11 Region: 102-186,486-528
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000643
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 12 Region: 3472-3511
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000353
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 13 Region: 2702-2739
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000419
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 14 Region: 2559-2602
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000772
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 15 Region: 3555-3593
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000101
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 16 Region: 3389-3428
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000445
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 17 Region: 3590-3631
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000105
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 18 Region: 3753-3791
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 19 Region: 487-525,814-864
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000251
Family Growth factor receptor domain 0.0084
Further Details:      
 
Domain Number 20 Region: 3514-3549
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000694
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 21 Region: 3707-3749
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000929
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 22 Region: 3671-3704
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000109
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 23 Region: 2523-2562
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000013
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 24 Region: 2620-2654
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 25 Region: 3633-3672
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000367
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 26 Region: 2781-2812
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000484
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 27 Region: 2883-2915
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000109
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 28 Region: 26-64
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000144
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 29 Region: 3352-3388
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000196
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 30 Region: 2831-2866
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000262
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 31 Region: 1090-1127
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000301
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 32 Region: 2921-2957
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000406
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 33 Region: 2742-2774
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000511
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 34 Region: 2665-2697
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000576
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 35 Region: 957-992
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000183
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 36 Region: 4348-4390
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000133
Family EGF-type module 0.019
Further Details:      
 
Domain Number 37 Region: 1037-1074
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000144
Family LDL receptor-like module 0.0026
Further Details:      
 
Domain Number 38 Region: 4312-4346
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000211
Family EGF-type module 0.025
Further Details:      
 
Domain Number 39 Region: 4275-4311
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000225
Family EGF-type module 0.013
Further Details:      
 
Domain Number 40 Region: 997-1034
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000288
Family LDL receptor-like module 0.0032
Further Details:      
 
Domain Number 41 Region: 3431-3473
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000785
Family LDL receptor-like module 0.0021
Further Details:      
 
Weak hits

Sequence:  FBpp0141889
Domain Number - Region: 4401-4439
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000147
Family EGF-type module 0.041
Further Details:      
 
Domain Number - Region: 2160-2208
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000201
Family EGF-type module 0.015
Further Details:      
 
Domain Number - Region: 1140-1174
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000275
Family LDL receptor-like module 0.0029
Further Details:      
 
Domain Number - Region: 4196-4243
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000295
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 4241-4276
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000439
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 70-104
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000929
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number - Region: 875-908
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00107
Family LDL receptor-like module 0.0032
Further Details:      
 
Domain Number - Region: 4445-4478
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00207
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 3793-3829
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00454
Family EGF-type module 0.011
Further Details:      
 
Domain Number - Region: 1842-1883
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00583
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 2477-2525
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00878
Family EGF-type module 0.029
Further Details:      
 
Domain Number - Region: 916-954
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0615
Family LDL receptor-like module 0.0036
Further Details:      
 
Domain Number - Region: 4161-4195
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0698
Family EGF-type module 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0141889   Gene: FBgn0115494   Transcript: FBtr0143397
Sequence length 4647
Comment type=protein; loc=scaffold_4929:complement(18520805..18520957,18521088..18521214,18521271..18522603,18522660..18523224,18523300..18524113,18524172..18524558,18524828..18526865,18527012..18527681,18528389..18530503,18530559..18530827,18530884..18531239,18531307..18531587,18531661..18533419,18533508..18534575,18534637..18535382,18535615..18535991,18536244..18536564,18536627..18536878,18537196..18537318,18537391..18537516,18540283..18540346); ID=FBpp0141889; name=Dere\GG23343-PA; parent=FBgn0115494,FBtr0143397; dbxref=FlyBase:FBpp0141889,FlyBase_Annotation_IDs:GG23343-PA,GB_protein:EDV59554,REFSEQ:XP_001970495,FlyMine:FBpp0141889; MD5=bf383ebb1e070785d6caf1111d2b05a6; length=4647; release=r1.3; species=Dere;
Sequence
MRWKCDSKADCPDMSDEGSECAEAPKCNEGQFRCGVSRHCIPNNWLCDGEFDCGKGDTSD
ELNCPNGATPKCRAFEGQCRNGDCLELSRFCDGHWDCDNDELQCDKQNAACAALNCSFNC
KLTPQGARCYCPKDQVPESSNSTRCVDYDECSEPGTCDQVCRNTPGSYECSCVSGYAKTK
GSRCRAINVPPTEPATLFFLSRDGVQRIGTNGEVIGPPGAKDNDKVTDKEGDGSAEEVLL
SQPLRFVHAFEVWHRNRTLCSLFFSWPELQMRCQRVDDARVNWTLPFSSFVSPQQFFSEL
RLDWLSGNWYLFSEDDGLVYLCTNAMTYCRVILQQVDPLSSLALDPTKGFMFYTDWKPSL
SRSLLDGTNRTVLVTDQVYHPSSVTLDLANELVYWIDIYKDEVNRVDYEGRNRWTLKRPL
DSPVPLKTIHAVEVFENSIYLAAWMDTAIVALDKFTLKAHILHSNVSRDANLRIFHRQKQ
PEVAHPCRDNNAGCNQICVPQWTKGFASAKCLCSAGYKLHNQTTCLLSALDKFLVYSDKH
LARISGIPLDTEQVQQLEQIGEQPDVMVPVYNVSKTLAIDVNVRGKAVFYVVADSVASSF
GNGEPSCSIRSQSLNGSVSRLLTQGLKRVHAMAFDWINDHLYWSNHKRMQVAPLRNLSKV
LTFNTDCDAMSLELDPTTGLLYWTQWESESCEAGIYSAWMDGTHKELLAKDTSTMPMQWP
RSLDVDRRTKELYWCDIRLSTIELMKLDGTGREVLFKSDQFHPYSIVQSNGLIYWADNKN
FTILRFHAHQANLSSTFSSTVHLQRTGRAADLRIFDIATQPLPQTPSACAQSKCPGMCLN
TPKGAICRCPDGFTLNGTGSHCIPQLAPSPIRPNCTSGYMCRSTRQCLDSKDMCDGFEDC
EDGIDESSDPKGPCNVNTCDKTHNFVCNGRCYQRSLLCSTIPYCSDGTDQANCHQNTCNS
NEFTCHKSGRCIQLTWVNDGVVDCGPDDDSDETSETILASKCPEFDCNNGRCRQFADVCD
GIDNCGNNADEMECEQECEHGEKYCRPIGCYGEMHMCDGIHDCVDFSDEANCNQTKSDNH
PSTGWKELSECAPLEFACMDPFECIPDFLRCDGIPHCFDKTDELNCTHINASRFDMNETV
ICEHPDRLCGFSKQCVTVDQLCDGKNDCEDTTDEGFLCADKLCDRGHECSHRCHNTPEGY
ICSCPDHLYLQPNGKRCSMQHACDHWDTCSQVCESSGKGYDCRCLDGFDLGFDRFTCKST
APDEPYVIFTNRQDIKGINLKTLNAGSFYSSLRNIIALDFLYNNESNVEIYWTDVIDDKI
YRGQLVGESLRNVEAVIHSGLSTTEGLAVDWVGKNLYWIDSNLDQIEVAKLNGSFRRTLI
AGNMESPRAIALDPREGLLFWTDWDDNSPRIERASMSGDGRRLISTSWQLSAGWPNGLTL
DYTQKRVYWVDAKSDSISSTMYDGSEHHVVLRNKEILSHPFAISVFENYVYWTDWRATSV
IRANKWNGSDVQVLQRTHSQPFGIQVLHSSRQPWDRNPCGENNGGCSHLCLLSGRGTFKC
ECPHVMRLDPANERNCVPNEQVLLFVMVDEIRGIDLHQPNHHTIPTIRQSPRRIDFLVEE
SRIFWSDIQQNEISSAGISNGLIEPIINTNIEKPYGFAVDWIARNMYFSSGQIKCNILAS
NLNGEFVTIIHEDLNMVDSIVLDPANGKMYWIHSASDGSMSQLEQSNLDGSSRLLIYQHE
NNLQSLTMDFDSQRLYYAYDNSGIAYYDIPRNETRKVLVASPITSISSLTVYNGTLYFPE
NIQSVIMQCEKEACSNMSYLRVNTKSIQSMKMFYADAQTGSNTCDKWAYRGGCQQLCLST
SSTDHVCRCALGYDVEPNNPTGCVPRAEFIFYSIDVLQGVEMIDPTEQFDTPSPALVPIS
RVSSASFIDYLAQRDTLYWGDNELGSISRVKRDGTHRETILEALNLVGYKQQDWLGGIAI
DWVAENIYWSDTKRNIIEVARLDGSHRYVVVSNLEKPTVLAVDPLQGLLFYVTQQHIGRV
GLDGSQPFVLVNQTRANWAVGSLVLDIEATKVYWCERYPDAIMKVDYDGNLREQLLNESL
NNPVALAKMGDYLYWAENKYNEGIIRVAPLANLSQSKVVLQTEQDAIRDLKIYSKHLQRG
SNPCAHSNGGCDQLCLFNGTSAVCACAHSRLASDGTSCEPYENFLLFSYRSNIESIHMTD
HADKNWPVQMISNSSLMRNVIAITYNYEEQLVYYSDVQLSTINQVHFNGTGQRVLLEQQQ
RVEGLAYDIVNEQLFWTSNNNATIRSVELRHLSEHADQNQVHVKKVLSLRENDKPRGIAV
EPCLGMIYWTNWNEGSPCIQRSYLTGYGTEVIIKTDIKMPNALTLDLEQQKLYWADARLD
KIERTNYDGSNRVVLAHSTPKHAFAMAVYGDLLFWTDWVLHAVVRANKYSGTDVLFLREH
VTRPMGIVAVQNSSINCDANQCKILNGQCEDVCILNKSGQATCHCTQGVLAPDGRRCIAP
VNTSCGLSQYNCHSGECIPLELTCDNVTHCADGSDEFRRYCIFRQCPETHFMCQNHRCIP
KEHKCDGVQQCGDGSDETPLLCKCQSEEIDMHPSNNHTREMPDMFRCGSGECIPRKFLCD
SLKDCRDFSDEKMCAPIPCEVSDMTFVHCANSTMCIMPRWRCDGDPDCPDGTDELDCANH
TGVSCDPGQFRCARGNCIAGSWHCDGEKDCADGSDELNCRFECGHNQFACDKTCIPASWQ
CDGKSDCEDGSDEGPQCPSQACRPHLFQCKSSGRCIPQKWVCDGEKDCPSGLGDEGSEDE
GPQCGGVAHIPDCPPPAHLCTSGLCIDSHYVCDGDEDCPGGDDEYEGCVPAFQPHSCPGG
ALMHQCQDGVCIFKNQTCDGKPDCADGSDEASSLCAHTRGCNGTDDFRCKNGACIHADLL
CDRRNDCADFSDEELCNVNECLIPDICEHECEDKVIGYQCHCRPGYKVLARSPHLCTDID
ECDEQQPCSQTCVNTYGSYKCLCAKGYALVDQHTCKATSNVSMELIFSNRYYIRQVDMTG
NGSILINELSNAVALDYDWDSQCLYWSDVTSTVGTIKRHCPKENKTQTLHQAMLKNPDGL
AVDWVAKNLYWCDKGLDTIEVSQLDGKYRKVLINEYLREPRGIALHPYQRHIFWSDWGDS
PHIGKAGMDGSNPKMIIRDGLGWPNALTISFETQQLFWGDAREDTISVSDLDGNHTRLLL
ARIINPLLNLHHIFAIAVWEGRIYWSDWETKSIEYCSIFNGQNCNTLITTIHRPMDLRVF
HPYRQQQPMSGNPCLAANCSTLCVLSPEEPYYKCMCPTNFMLADDGRTCRANCTAAHFEC
VNTYKCIPFYWRCDTQDDCGDGSDEPESCPPFHCEPGQYQCANKKCTHPSNLCDGINQCG
DGSDELNCDKFTCFDNHMKCGATANSSAFCVDNVKRCDGVRDCPGGEDESECTPLVCKKD
QFQCGNNRCMPFVWVCDGDIDCPDKSDEANCDNVSCGPNDFQCDSGRCIPLAWRCDDEHD
CPNGEDEPKSCFSSKATCDPTYFKCNNSKCIPGRWRCDYENDCGDGSDELNCQMRNCSES
EFRCGTGKCIKHNYRCDGEIHCDDNSDEINCNITCKENQFKCAAFNTCINKQYKCDGDDD
CPDGSDEVNCTCHSDHFTCGNGKCIMSRWKCDGWDDCLDGSDESLETCAKIHCHANAFKC
RNQLCIRNSALCDGVNDCGENEDESDAVCAALPKCRHDQFQCENDDCISKAFRCDGQYNC
VDGSDEMNCQPPVCGFGSCSQICIEKKAGHYNCKCADGYHKGPEKNATCLASGPDQILLL
ASEQEFRFILPAKQEGTTVVGFFQTDSLKIDVFDILIRPKDTLLFWIDSHHGKVHTMKIA
TPHVEGTGVRVRRDLKELTAFNIPELDDPKSLAVDWISQRVYIIDSRHNQILATDIEGKK
YISLVSTGMNPTDIVLEPESRIMIWSTLENGILVASLDGSNKKSLVERDVGWPISLSMDY
PTGRLYWADYRKGTIETCRLNGKDRNVVRRFGNREKPQKIDVFEDYLYIKLYDQSIIKMN
KFGNDNGTYLLKGYRSSDIGILHPMKQNRNISNPCAKDPCKSYRALCIPSSESSVGYSCK
CAEGYVMTDDGVCKAHSDIPDYCPLQCNLGTCKIVDHVPKCICQPQFEGELCEHYRCSGY
CQNYGVCSVAPALPGSQEPPPLKCTCTAGWSGARCETSMPACQSRCHNGGSCLISETEGM
KCSCPKMFTGEQCEHCQSLTCENGGICRETLTGTPQCECPDGFTGKRCEINECADFCKNG
GSCVISTKGQRQCKCPSGFFGEHCESNSCHDFCRNGGTCSERDGRLSCTCPPRYIGESCE
SDLCKTSSPPHFCDNTKVPTRDPCTLMICQNAGTCHIIKGVALCNCTDQWNGDLCTIPVA
DDNPCARYCANGGVCHLDEYRLPHCSCIGEWQGNACEMPPHCVGGECNVCRQGSSINECL
CEINRVVPCLSDSADALKGEQESTESGGVFSVLVVVLAVILLVLALFAGAVYFLKKHRIA
QPFSHARLTDNVEIMLTNAMYRGDADEAPTFASEDDKGNFANPVYESMYADAIPEPVSTE
ITHSTAPDERKGLLQHTHDENHTPDIL
Download sequence
Identical sequences FBpp0141889

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]