SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0141985 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0141985
Domain Number 1 Region: 182-228
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000671
Family EGF-type module 0.016
Further Details:      
 
Weak hits

Sequence:  FBpp0141985
Domain Number - Region: 33-90
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.00275
Family Apolipoprotein A-I 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0141985   Gene: FBgn0115586   Transcript: FBtr0143493
Sequence length 295
Comment type=protein; loc=scaffold_4929:complement(17340211..17340410,17340579..17341196,17341690..17341759); ID=FBpp0141985; name=Dere\GG23439-PA; parent=FBgn0115586,FBtr0143493; dbxref=FlyBase:FBpp0141985,FlyBase_Annotation_IDs:GG23439-PA,GB_protein:EDV59369,REFSEQ:XP_001970310,FlyMine:FBpp0141985; MD5=8b5e03d756edeb8178d519d3687b292b; length=295; release=r1.3; species=Dere;
Sequence
MMQIPFTRIFKVIFVLSTIVAVTDCCSSRILLLREHTLKIVQHQHSHMHEHAHELQQQIQ
ETAVELLNRLELQRKQLEASAQEEADQLQPDTDTSPDAGSQLPNADDFNAADPEQDGVVL
GSSTVTWLGSESSTPITDSETVTTPETVTHTGEPPPDQSSSSTPGSTTSSPNDKETEIQM
LPCSEAYNTSFCLNGGHCFQHPMVNNTVFHSCLCVNDYDGERCAYKSWNGDYIYSPPTAQ
RKVRMAHIVFSFPVLIMLSSLYVLFAAVFMLRNVPDYRRKQQQLHLHKQRFFVRC
Download sequence
Identical sequences B3N7G4
XP_001970310.1.56816 FBpp0141985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]