SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0142140 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0142140
Domain Number 1 Region: 824-1038
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.32e-105
Family Thrombospondin C-terminal domain 0.000000187
Further Details:      
 
Domain Number 2 Region: 702-821
Classification Level Classification E-value
Superfamily TSP type-3 repeat 2.48e-32
Family TSP type-3 repeat 0.0000149
Further Details:      
 
Domain Number 3 Region: 642-733
Classification Level Classification E-value
Superfamily TSP type-3 repeat 3.79e-17
Family TSP type-3 repeat 0.0000591
Further Details:      
 
Domain Number 4 Region: 562-644
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.00000000000183
Family TSP type-3 repeat 0.00026
Further Details:      
 
Domain Number 5 Region: 470-517
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000249
Family EGF-type module 0.01
Further Details:      
 
Domain Number 6 Region: 383-519
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000014
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 7 Region: 524-564
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000356
Family EGF-type module 0.038
Further Details:      
 
Weak hits

Sequence:  FBpp0142140
Domain Number - Region: 343-396
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0963
Family EGF-type module 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0142140   Gene: FBgn0115735   Transcript: FBtr0143648
Sequence length 1060
Comment type=protein; loc=scaffold_4929:complement(15597127..15597197,15597266..15597399,15597459..15598942,15599003..15599325,15601097..15601218,15607339..15607456,15607575..15607769,15610099..15610236,15610326..15610455,15610517..15610832,15610890..15610956,15612195..15612279); ID=FBpp0142140; name=Dere\GG23594-PA; parent=FBgn0115735,FBtr0143648; dbxref=FlyBase:FBpp0142140,FlyBase_Annotation_IDs:GG23594-PA,GB_protein:EDV59116,REFSEQ:XP_001970057,FlyMine:FBpp0142140; MD5=5009059b1cec164dc8ac56b611514f09; length=1060; release=r1.3; species=Dere;
Sequence
MNWTRVLLIGLTALALTFVEVASLSLDPVASAELEQFIRKGDVVISTRHIRPRRKLHISI
EALFMIDFPMLKHKMSFFLDRKQQRVTLDISANGATESRNFEIPNINETSTIRSLALQFS
KNRITLYVDCKASTHHDIDMNLAKLYTQMDDPVIKLFRERKYPLHFDGDMEHSLQRANCQ
KGSHRRGNRRMLRNKITEREKNKKRDVRGWYEPTIAREGVVDHRHQEVPTDVERGDIPVL
NGDCEDALARSLSDLLALVKLLREDVAHQRQEIAYLRMLLENCAGCKNPLTPDNQLRIEP
DCRSANPCYPGVECLDSAAGPRCGHCPLGFIGDGKSCKPGVTCAHHMCYPGVQCHDTVNG
AQCDSCPAGYEGDGRTCSLRNPCLDTPCPSGAQCLQVGYPPYFHCISCPMGHEVNGTSCR
DMNECQLYDPCDELTTCTNLSPGFQCSPCPVGFDGIHAHGYFADYYSVDYRRQTCLDVDE
CRTGFFRCPEHSTCINEIGSYRCQCHEGYVTNGTYSCLDRSSVSVCTDGTVCDRNAVCLR
MDNRRHKCHCNVGWAGNGLICGRDTDVDGWPDQAIGCPELHCQRDNCPKLPNSGQEDADL
DGYGDGCDDDADGDNVQNSQDNCWLAYNTEQLDSDGDKVGDVCDNCVLKYNPRQLDTDED
GLGDECDGDIDNDTIPNELDNCPLLPNPSQSDVDNDGVGDGCDNCPNLPNPDQKDRDMDF
VGDACHRDIDGDDDGVPNSLDNCPMVSNSDQLDTDGDGTGDECDDDMDGDGIPNYKDNCP
LAKNPKQEDFNRNGKGDSCEDDEDVDGVPNAMDNCPNNSMIHHTDFRTLQTIPLDPKGLS
QADPNWVVHANGTEIVQTLNSDPGLAVGKDAFGGVDFDGTFYINDDTDDDYAGFVFSYQS
SYKYYVVQWKKGTQTYWEPRPFTASAAPGIQIKLVNSTEGPGPMMRNSLWHEGNTDGEAR
LLWKDPKNIAWKERTSYRWSLVHRPAIGLIRLQMHEGNHLIFDSGNVFDSTLKGGRLGVF
CFSQRMIIWSNLQYKCNNRVEPLIYNDLSDYLKTKVELQD
Download sequence
Identical sequences FBpp0142140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]