SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0142460 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0142460
Domain Number 1 Region: 3187-3365
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.09e-33
Family Laminin G-like module 0.00098
Further Details:      
 
Domain Number 2 Region: 2775-2953
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-26
Family Laminin G-like module 0.007
Further Details:      
 
Domain Number 3 Region: 3000-3178
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.39e-26
Family Laminin G-like module 0.0071
Further Details:      
 
Domain Number 4 Region: 2580-2770
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.24e-25
Family Laminin G-like module 0.0044
Further Details:      
 
Domain Number 5 Region: 2394-2566
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000749
Family Laminin G-like module 0.04
Further Details:      
 
Domain Number 6 Region: 1291-1339
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000173
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 7 Region: 1147-1193
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000184
Family Laminin-type module 0.0057
Further Details:      
 
Domain Number 8 Region: 1062-1105
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000187
Family Laminin-type module 0.0063
Further Details:      
 
Domain Number 9 Region: 849-901
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000209
Family Laminin-type module 0.0047
Further Details:      
 
Domain Number 10 Region: 398-451
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000781
Family EGF-type module 0.088
Further Details:      
 
Domain Number 11 Region: 1667-1716
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000273
Family Laminin-type module 0.0065
Further Details:      
 
Domain Number 12 Region: 932-973
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000067
Family Laminin-type module 0.0076
Further Details:      
 
Domain Number 13 Region: 1196-1244
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000103
Family Laminin-type module 0.0054
Further Details:      
 
Domain Number 14 Region: 1723-1772
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000151
Family Laminin-type module 0.033
Further Details:      
 
Domain Number 15 Region: 1015-1056
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000446
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 16 Region: 971-1010
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000109
Family Laminin-type module 0.0056
Further Details:      
 
Domain Number 17 Region: 449-491
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000502
Family Laminin-type module 0.024
Further Details:      
 
Weak hits

Sequence:  FBpp0142460
Domain Number - Region: 562-599
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000156
Family Laminin-type module 0.015
Further Details:      
 
Domain Number - Region: 1770-1811
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000698
Family Laminin-type module 0.034
Further Details:      
 
Domain Number - Region: 221-282
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00104
Family APC10-like 0.069
Further Details:      
 
Domain Number - Region: 1337-1389
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00229
Family Laminin-type module 0.013
Further Details:      
 
Domain Number - Region: 503-543
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00586
Family Laminin-type module 0.035
Further Details:      
 
Domain Number - Region: 1244-1288
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00586
Family Laminin-type module 0.014
Further Details:      
 
Domain Number - Region: 807-839
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0193
Family EGF-type module 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0142460   Gene: FBgn0116053   Transcript: FBtr0143968
Sequence length 3372
Comment type=protein; loc=scaffold_4929:complement(11137336..11137490,11137603..11137831,11137892..11138025,11138085..11138703,11139603..11140260,11140319..11140469,11140526..11140808,11140870..11141622,11141680..11143367,11143456..11143852,11143909..11144164,11144230..11145589,11177336..11178144,11178428..11180319,11187717..11188045,11200972..11200980,11202101..11202497); ID=FBpp0142460; name=Dere\GG23914-PA; parent=FBgn0116053,FBtr0143968; dbxref=FlyBase:FBpp0142460,FlyBase_Annotation_IDs:GG23914-PA,GB_protein:EDV58581,REFSEQ:XP_001969522,FlyMine:FBpp0142460; MD5=6a0e3e58fb4c32fe105b82a8d24b4326; length=3372; release=r1.3; species=Dere;
Sequence
MQIGNYIKWPLGLILILLLTHCQAKRQRKRLRGFSSAKDLQDYSLPLNDSSSELQQNIVS
WTGTRIASSPEKKKKSPQSSRRHKTKSGLVIESNIADSESMLANASSESVTKKKPPPQRR
RNGKLQKSGGGGGGGSLRLLKTDDLYSSSSSGGLYPPLFNVVPRAQISVNATCGQDGAEE
YCKQVGAKPCGICNAHSSDRAKQRSIQSLISSASGSGFEEGWWQSPTLQGGRQFEYVTIQ
LDLKQTYQIFSVWLKSANSPRPASWILEKSLDGINFEPWQYFGLSDADCQRRWSLSGQNG
KYVFQNDTEIICSTQFSKPGPLENGVLHASLLKNRPGATDQSPELMKFITTRYIRIRLQG
MHSTAKQDNSLDWLLDSPSLEKHSFYSLSQLKVSARLDCHGHANRSHESPEDPLLQCVCQ
HNTCGAQCEQCCPLFQDRPYQLGGECEICQCYGHAESCTYDSYLDKGICQSCSNNTAGNE
CEFCEMGFYRELDAPLTDPCLPCSCNPARSTGGCQSDGGSCNCLEGFQGKNCEECAPGYY
GDECKRCECDERGSRGSKGSCSGVCQCKLNVEGSTCSECAPGYFDLSAENADGCTSCWCS
GVSQTCHSAKLQTLAFETLNDWKITDIQRVKPISIPVDTETNRLIFANELDEVEAIYWQA
PLGYLGNRLTSYGSRLQLVLTWDVIRGDTSGKPTTGPNVILVGKNGLKIAFGDESLDGLV
VNLNVTLTEVGWYHVPPTVVDIKSRLRRTEGGDYHGEYVTRSQFLSVLVSLDAVLIRAAF
HTDQGETSLERAVIYSGGVELGGKSSSQVEQCLCPAGYTGLSCEGCAFGFKRIYENTTDH
QILSKCIPCPCNGHSNSCDLQSGNCGDCMHNTFGDRCERCQLGYYGNPLQGTPHDCKRCA
CPLSEDSNNFSPSCQLKSYNYMDLNPQFELIEHAEYICTQCPEGYTGDHCQVCDDGYFGN
PRQLGSSCQRCDCAGGPCNVTTGECITCRGNTEGWHCERCKLGYWGDPAVGCDPCHCHTE
GSESGLCDSTDGQCLCKPRYAGQKCNECDVGYANVELRCPSCNCDPLGSLVQDRCDPHTG
QCHCKLGVMGAKCHECQDGYFGMNAVAERMDDLAALRQNSDGDDDDWELVPDTEDPNSES
AVACEECHCSSVGSLSSDCDKRTGQCACLANVTGRRCDKCRPGHWNLTADEGCRDCRCDP
HGSRGHECNPWTGQCDCKIGVGGQHCNECTEGFYGFNNEGCQRCSACRSEGQVCDPHNGR
CICPKFTRGLGCGQCVPGTWDWQARLGCRECDCDHIGSIGQHCNTGDGQCQCREGYSGRK
CDTCAVGYFGYPECRRCGCDPEGSFTQADGSIACDSNGQCPCKSLVVGLKCDTCMQSTFG
LSALNPEGCTRCFCFGRSGDCEQSDLSWGHIRMAESRNLSVQQITPHTVPSSDYEYIVVV
QMEGSSFHREDAEIQRMNDLSLVPKSTGNVSIGAYGQFYHPLYFQLPPQFYGDRTSSYGG
FLYFTLITEGAHKPLERNILGQYPLVQLHAHSKLLLDFYEYEEFEYSLNVTHRVPLHESF
WKYHHTSQAVDRNTLMAALQNIRHIFIRAFAFADFQEVVLQNVHMDAAIYIKGSTNLIAK
GVERCRCPKRFDGLSCQDPGRSFYRWRNTTVVESVFIEDLIGRAAPCHCNGRSSDCDRET
GVCQGCRGNTGGDHCHQCAEGFYGDPNSPHGCQACPCPETNRNFARGCNVWDGEVSCVCK
PGYTGRLCERCQAGYFGDPMRYPNTTCQPCNCHPDGVRTEGCDIETGRCYCREGVTGLKC
DKCQAERHHLVENGCRICDNCTLLLLDYVELVGHKLRRGMHNMDLTGIPAPYRKLSQYES
AYGEWNGRHWDFSQAKRRLQDYDSANILKMEAHAENLKFQSRKAVATIGKREFAIKSMRE
DAVVQQHSVGLLRSEILQTLSDLHGYGKSAHYLSLPTALKQARFYLQAIREHDQMVQGIR
STNDCAWKHFYAMGNASDASFDESGRLEMLWRDLNQTNHRVVDMRLQLDRVQEVENEAED
VLEHVRNLCVHVGESHQELDDLKQRISNHLDPGYLEQGEGLLRLTVQRQILLNGHLNQLD
GYRVLLNTTLGVKLEQQREVHKHWLPKAERHASHLLARSNEYARQFQPTRNGARIAMLAS
SAHSNITKAINDARLASILAKERVYEAQRTLYPSDGSSMIERAKHSLHRSKQLQQEALKQ
MHKSNVLKDKLHRQEQQVEGIKATIYDSGLRTNNISGQLQGLSEGSARRQAKDSLELADR
TGEQMRAELRLAKDMQKSIQNMRKSFSNLEPDWEIKLGMAQENISLTQTNLRLANVSLSY
LEQQAEKEQQVFEVWNNSMAQQLQLLRDQIAKARHAAEAIDVSLESLGPKCIRSYLPTSY
GLSTSNKLRMSFALSNHLESSPMIHLASSEGRHITLELYKRRVRLVWNLGGTTATVTHPM
LVHTRDPKYDDAWYHVEANRTLNLGSLVVRRMNNYGELTPANPVTIAGSTDADHTRFYQS
RSDRISLGGFASKDLQFTPGLNVVVHQVEVDSKPLGLWNFVTSEGSCGGSMAGAKESSAS
STARHFNGLGYAQLMKTRPRPTRKNLFSVQMTFRTLDENALLFLAVDDKNNRSVSVTLSR
GRIMFRIDYGDESKLEINTTKKYNVGQWIKIEAAREFSAKRSTENGMLRVNNDRPISGAP
TLPVNIHLLPDLSKAVYYLGGVPPGFTSGTSKAPGADNPFLGCMKDVQVNGETYDPLESS
SYYGVEPSCKDMITKAGFSGNGYLELPSQSLRKRSNTAMVFRTLQPDCLLLLAAYPPEIL
GDYDAKDIKGNFSISLVDGQLHVWVNSGRSFIKMSSNSSQMNDGEFHVVNLIKTGRRLEL
MVDDELQEIRNLNGNPTVVSLPRDAGGLYIGGAPPHESYTPLAPTFVNLEGAIRDVVFNN
RTINFNDALTFANVQIGRNGPLMGSLKGGLYDVLLKTEPMIGKSFTASPEGCKRIGSYSY
EPNAFKFGDDIYSYSQLKLPERHFWQRNFHLSFDFRSFYPNGMIYLSPGSKEKPKHYVTL
VLKDGQLVLVVRGRRREELQLTAKLNDGEWHRVTISCHDRKVTMSVEIGRTDQKTSAQMK
LPKKIGASQLLLVGGLPQSPVKVSSDLYVRLEPFKGCLRRVSINNNTQDLARPGKHSNVG
QCFPTVERGSYFPGDAYAIYKKNFNVGKYLDLETEFRTSELSGILLSVSDSNGYPALSLE
LHNGNIIFSCDPGNGVPMRVESSLPTKYALCDNKWHNISALYDGEQIVLRIDQLPAVISV
GNQGNAGKVQTRSPLYIGGLPENAPSGSLISRENFKGCIRHVSIRNERRDWIEMEDLRNV
LLSECLVSSDES
Download sequence
Identical sequences B3N9T6
FBpp0142460 XP_001969522.1.56816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]