SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0142523 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0142523
Domain Number 1 Region: 255-303
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000434
Family EGF-type module 0.024
Further Details:      
 
Domain Number 2 Region: 76-207
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000929
Family Spermadhesin, CUB domain 0.0069
Further Details:      
 
Weak hits

Sequence:  FBpp0142523
Domain Number - Region: 212-252
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000352
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0142523   Gene: FBgn0116116   Transcript: FBtr0144031
Sequence length 384
Comment type=protein; loc=scaffold_4929:complement(10741048..10741298,10742556..10742647,10743027..10743134,10751714..10752417); ID=FBpp0142523; name=Dere\GG23977-PA; parent=FBgn0116116,FBtr0144031; dbxref=FlyBase:FBpp0142523,FlyBase_Annotation_IDs:GG23977-PA,GB_protein:EDV58462,REFSEQ:XP_001969403,FlyMine:FBpp0142523; MD5=cc538916f395a5025fdbaf9a59c0842e; length=384; release=r1.3; species=Dere;
Sequence
MTLVRLAATIWLLTLLLPAVLPHQMPPDADQKFSLPAVPLPPPPPFQPGKNHFALNAFAG
GEHASGGHAHSSTSSPGCGGMLKARHGNIQTPNFPHRFATPIECVWIIDATDMPPQGQAN
VSIVVYLTQLYVLSGLKFTEYMYYSDDFKVPAHRVFTLTEDDVTQVTWVQFHSQYLEIRF
TMATLDGTHLRALDRLLDVYGFNITYEVQNEVKTSQCNALQCRFLGDCYASEDYSSYACS
CFPGFSGGDCGHGPLCKDLHTNVCQNGGTCKHIGDAAITCHCPKGFKGTRCEIPEINETT
QGCTSNSSSIECHQACDFDNFGRSVSPPGQSYSAPKGNRNAARSGKTRYEVTMRLGANLT
GYYRHADREQLSGVMERQVSSRYT
Download sequence
Identical sequences FBpp0142523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]