SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0142707 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0142707
Domain Number 1 Region: 325-542
Classification Level Classification E-value
Superfamily GFP-like 3.87e-57
Family Domain G2 of nidogen-1 0.00031
Further Details:      
 
Domain Number 2 Region: 1046-1285
Classification Level Classification E-value
Superfamily YWTD domain 4.05e-36
Family YWTD domain 0.00000389
Further Details:      
 
Domain Number 3 Region: 284-321,548-632
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000895
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 4 Region: 940-1037,1297-1338
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000105
Family Growth factor receptor domain 0.023
Further Details:      
 
Weak hits

Sequence:  FBpp0142707
Domain Number - Region: 836-874
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00719
Family EGF-type module 0.053
Further Details:      
 
Domain Number - Region: 790-829
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0289
Family EGF-type module 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0142707   Gene: FBgn0116294   Transcript: FBtr0144215
Sequence length 1350
Comment type=protein; loc=scaffold_4929:complement(8165994..8166249,8166309..8166593,8166656..8166830,8166888..8167142,8167673..8167830,8168004..8168413,8168474..8168619,8168683..8168953,8169294..8169917,8169986..8170747,8170841..8171320,8173059..8173289); ID=FBpp0142707; name=Dere\GG24161-PA; parent=FBgn0116294,FBtr0144215; dbxref=FlyBase:FBpp0142707,FlyBase_Annotation_IDs:GG24161-PA,GB_protein:EDV58124,REFSEQ:XP_001969065,FlyMine:FBpp0142707; MD5=589d65ed47db30f6f7ac58332c2c2347; length=1350; release=r1.3; species=Dere;
Sequence
MPTFGSKLLACLLLSSVILASGQFEHYLDSLRASELYEFEEGSLGSIQFLPKGDSETIVL
QLEQPIHFYGEQYEQLYINTNGILTFNSEFPEYLNQPFPLEYASIAAFYSNVDTSLSDEG
TSIFLFESREQSILDRASSLVRYAFSSQPEFEARQVIVATWRNVGYFDSKTDRLNTFQVA
LIANEQSTFVQFIYPDGGLNWVQGETAGLGLPDIRAQAGFVAEDGRFYTLNGSGSENARF
LSESTNLGVPGVWLFEVAPIENERNVRTPDNAESLTESPALAQSCQAHAHQCHENAECHD
KAEGYCCVCANGYYGNGKSCLANEQPIRVTGTFTGELNKQPVSEDAKLQSYVVTSEGRTY
TTINPLTPELGAKLRLVLPLLTTVPWLFAKSVGGVANGYQLTGGVYTHVSRLQFNSGESL
HVNQTFEGLNYWDQLSVKIEIYGDVPEVAADAVLILPDYVEEYTFERPGELRSVQVLNLN
VTEEQRVLELQVEQRILYRSCLRDDEADPSATKVLQKISKVALDYVERDQALRIGAMSKV
GVTAESNACNDGTADCVENSVCVPYEDTYRCDCYHGFDAQLDERGVEVCLDIDECNTGSH
ACDENAICDNTEGGFSCYCIEGFEGNGYRCLSNSTADNIEYPPAVEGQAEPTSEPNPDPS
PYPDQGREEEREREPGQNPDPEPYPYPDEQVAQHPDECYHCSKDADCYKGRCTCHDGFAG
DGYTCTNICGHDDVWENGRCEPLLLERHDVDPFCDALGECRCPYGYELSEGSQRCTYVPE
IDGERNADLIPCDVDENCHSNATCSWYGVELRHICTCQQGFRGDGYNCDPISDDSCAIRP
DICDVHATCVYDEQLGKSMCQCQTGYEGDGFRCQLAAECQSDEQCGENAICDDGVCRCEP
EFERDVSDRCVPVGRCGSVFCGSNAFCMWDALQSVQYCDCLEGYQGDALTGCTSKPVSCH
VLYNCGIHATCEPTEDPANYECQCIAGYKGDGYVCIELENCLNNPTLCDMNAQCRSTNSG
LVCVCNQGFYGNGSFCQERQHQDSDFLIVSQGVMIARVPLNGRNVRPISVAQMAIGLDKD
CVEGRVYWGDISTKKIVSAKYDGTDLRPFITTDIDSPEGIAIDVISRRLYWADSEKDTIE
VASLEDSSLRAVIINKQLVNPRGIAVDPYREKLFWSDWDREAPKIEMSNLDGTGRELLLG
KDAVSLPNSLVVLENSGEVCYADAGTKKVECIQPQSRQIRTISNELTYPFGITFTHDQFY
WTDWSTKKVEIVDSLGARQTAIQPPFFGSHKMYGMTVVEQNCPQYQSPCQINNGGCTDSR
LCLVNRQAPSGKSCKCTSASTGCTVPTPGY
Download sequence
Identical sequences B3N6F5
FBpp0142707 XP_001969065.1.56816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]