SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0142914 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0142914
Domain Number 1 Region: 264-372
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000251
Family Growth factor receptor domain 0.0093
Further Details:      
 
Domain Number 2 Region: 181-290
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000957
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 3 Region: 129-175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000001
Family EGF-type module 0.012
Further Details:      
 
Domain Number 4 Region: 624-760
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000188
Family Growth factor receptor domain 0.0065
Further Details:      
 
Domain Number 5 Region: 2393-2442
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000671
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 6 Region: 492-625
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000832
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 7 Region: 2222-2259
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000886
Family EGF-type module 0.012
Further Details:      
 
Domain Number 8 Region: 454-508
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000126
Family EGF-type module 0.014
Further Details:      
 
Domain Number 9 Region: 408-448
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000401
Family EGF-type module 0.01
Further Details:      
 
Domain Number 10 Region: 3985-4008
Classification Level Classification E-value
Superfamily DPY module 0.000000798
Family DPY module 0.00085
Further Details:      
 
Domain Number 11 Region: 1334-1474
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000014
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 12 Region: 826-868
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000209
Family EGF-type module 0.012
Further Details:      
 
Domain Number 13 Region: 915-954
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000566
Family EGF-type module 0.017
Further Details:      
 
Domain Number 14 Region: 1016-1064
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000611
Family EGF-type module 0.01
Further Details:      
 
Domain Number 15 Region: 2746-2790
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000107
Family EGF-type module 0.025
Further Details:      
 
Domain Number 16 Region: 1141-1183
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000209
Family EGF-type module 0.016
Further Details:      
 
Domain Number 17 Region: 2342-2500
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000298
Family Growth factor receptor domain 0.0059
Further Details:      
 
Domain Number 18 Region: 3888-3911
Classification Level Classification E-value
Superfamily DPY module 0.0000418
Family DPY module 0.0016
Further Details:      
 
Weak hits

Sequence:  FBpp0142914
Domain Number - Region: 4108-4257
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00022
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number - Region: 1237-1385
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000345
Family Growth factor receptor domain 0.006
Further Details:      
 
Domain Number - Region: 2632-2795
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000377
Family Growth factor receptor domain 0.0081
Further Details:      
 
Domain Number - Region: 876-924
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00119
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 4053-4086
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00147
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 984-1029
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00237
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 4091-4114
Classification Level Classification E-value
Superfamily DPY module 0.00327
Family DPY module 0.0032
Further Details:      
 
Domain Number - Region: 1851-1885
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00462
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 2498-2519
Classification Level Classification E-value
Superfamily DPY module 0.017
Family DPY module 0.0033
Further Details:      
 
Domain Number - Region: 2179-2336
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0188
Family Growth factor receptor domain 0.0075
Further Details:      
 
Domain Number - Region: 791-837
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0196
Family EGF-type module 0.044
Further Details:      
 
Domain Number - Region: 1570-1602
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0231
Family EGF-type module 0.066
Further Details:      
 
Domain Number - Region: 3766-3788
Classification Level Classification E-value
Superfamily DPY module 0.0235
Family DPY module 0.0029
Further Details:      
 
Domain Number - Region: 3385-3405
Classification Level Classification E-value
Superfamily DPY module 0.0418
Family DPY module 0.0028
Further Details:      
 
Domain Number - Region: 3135-3157
Classification Level Classification E-value
Superfamily DPY module 0.0432
Family DPY module 0.004
Further Details:      
 
Domain Number - Region: 3506-3538
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0451
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 3550-3579
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0686
Family Follistatin (FS) module N-terminal domain, FS-N 0.088
Further Details:      
 
Domain Number - Region: 3623-3644
Classification Level Classification E-value
Superfamily DPY module 0.0719
Family DPY module 0.0037
Further Details:      
 
Domain Number - Region: 3445-3466
Classification Level Classification E-value
Superfamily DPY module 0.0745
Family DPY module 0.0034
Further Details:      
 
Domain Number - Region: 2066-2086
Classification Level Classification E-value
Superfamily DPY module 0.0759
Family DPY module 0.0045
Further Details:      
 
Domain Number - Region: 1192-1214
Classification Level Classification E-value
Superfamily DPY module 0.0902
Family DPY module 0.0041
Further Details:      
 
Domain Number - Region: 2882-2905
Classification Level Classification E-value
Superfamily DPY module 0.0955
Family DPY module 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0142914   Gene: FBgn0116500   Transcript: FBtr0144422
Sequence length 4310
Comment type=protein; loc=scaffold_4929:complement(4577132..4578219,4580256..4580444,4631479..4632276,4635666..4635758,4635820..4637628,4637730..4638038,4638552..4645829,4646509..4646865,4647075..4647584,4656221..4656337,4656419..4656520,4656593..4656821,4660138..4660191); ID=FBpp0142914; name=Dere\GG24368-PA; parent=FBgn0116500,FBtr0144422; dbxref=FlyBase:FBpp0142914,FlyBase_Annotation_IDs:GG24368-PA,GB_protein:EDV57747,REFSEQ:XP_001968688,FlyMine:FBpp0142914; MD5=bf7aeabab61954daa842017ba2af5507; length=4310; release=r1.3; species=Dere;
Sequence
MKIFLPLVTWIVLLLSSAVHSQYSQQPQPFKTNLRANSRFRGEVFYLNLENGYFGCQVNE
STEYLQLFNLSKLCDGTQDCFLGADELSKELKCTNDCDKDGTKCTHGACLNGVCHCNDGY
GGCNCVDKDENECKQRPCDVFAHCTNTLGSFTCTCFPGYRGNGFHCEDIDECQDPAIAAR
CVENAECCNLPAHFLCKCKDGYEGDGEVLCTDVDECRNPENCGPNALCTNTPGNYTCTCP
EGYVGNNPYREGCQDVDECSYPNVCGPGAICTNLEGSYRCDCPPGYDGDGRSESGCVDQD
ECARTPCGRNADCLNTDGSFRCLCPDGYSGDPMHGCEDVDECATNNPCGLGAECVNLGGS
FQCRCPSGFVLEHDPHADQLPQPQNTQQLGYGPGATDVAPYQRTSGAGLACLDIDECNQP
DGVAKCGTNAKCINFPGSYRCLCPSGFQGQGYLHCENINECQDNPCGENAICTDTVGSFV
CTCKPDYTGDPFRGCVDIDECTALDKPCGQHAVCENTVPGYNCKCPQGYDGKPDPKVACE
QVDVNILCSSNFDCTNNAECIENQCFCLDGFEPIGSSCVDIDECRTHAEVCGPHAQCLNT
PGSYGCECEAGYVGSPPRMACKQPCEDVRCGAHAYCKPDQNEAYCVCEDGWTYNPSDVAA
GCVDIDECDAMHGPFGSCGQNATCTNSAGGFTCACPPGFSGDPHSKCVDVDECRTGASKC
GAGAECVNVPGGGYTCRCPGNTIADPDPSVRCVPIVSCSANEDCPGNSICDATKRCLCPE
PNIGNDCRHPCEALNCGAHAQCMLANGQAQCLCAPGYTGNSALAGGCSDIDECRANPCAE
KAICSNTAGGYLCQCPGGSSGDPYREGCITSKTVGCSDANPCATGETCVQDSYTGSSVCI
CRQGYERNPENGQCQDVDECSVQRGKPACGLNALCKNLPGSYECRCPQGHNGNPFIMCEI
CNTPECQCQSPYKLVGNSCVLSGCSSGQACPSGAECISIAGGVSYCACPKGYQTQPDGSC
VDVDECAERGAQLCAFGAQCVNKPGSYSCHCPEGYQGDAYNGLCALAQRKCAADRECASN
EKCIQPGECVCPPPYFLDPQDNNKCKSPCERFPCGINAKCTPSDPPQCMCEAGFKGDPLL
GCTDEDECSHLPCAYGAYCVNKKGGYQCVCPKDYTGDPYKSGCIFESGTPKSKCLSNDDC
ASNLACLEGSCVSPCSSLLCGSNAYCETEQHAGWCRCRVGYVKNGNGDCVSQCQDVICGD
GALCIPTSDGPTCKCPQGQLGNPFPGGSCSTDQCSAARPCGERQICINGRCKERCEGVVC
GIGATCDRNNGKCICEPNFVGNPDLICMPPIEQAKCSPGCGENAHCEYGLGQSRCACNPG
TFGNPYEGCGAQSKNVCQPNSCGPNAECRAVGNHISCVCPQGFSGNPYIGCQDVDECVNK
PCGLNAACLNRAGGFECLCLSGHAGNPYSSCQPIESKFCQDANKCQCNERVECPDGYSCQ
KGQCKNLCSQASCGPRAICDAGNCICPMGYIGDPHDQVQGCSIRGQCGNDADCLHSEICF
QLGKGLRKCVDACSKIQCGPNALCVSEDHRSSCICSDGFFGNPSNLQVGCQPERTVTEEK
DKCKSDQDCNRGYGCQASVHGIKECINLCSNVVCGPNELCKINPAGHAICNCAESYVWNP
VVSSCEKPSLPDCTSDANCPDASACRPDVLGVLKCVAICDAFTCPANSVCVARQHQGRCD
CLNGFVGNPNDRNGCQAAQKHHCRNHAECQESEACIKDESTQTLGCRPACDTVKCGPRAV
CVTNNHQAQCQCPPGPFAGDPYDPFNGCQSVPCVYNHDCPPSQMCNRMTHTCFDVCDEES
CGDNAICLAEDHRAVCQCPPGFKGDPLPEVACTKQGGCAAGTCHPSAICEVTPEGPVCKC
PPLFVGDPKSGGCRPDGQCPSGDADCPANTICAGGICQNPCDNACGSNAECKVVNRKPVC
SCPLRFQPISDTAKDGCARTISKCLTDVDCGGALCYNGQCRIACRNTQDCSDGESCLKNV
CVVACLDHSQCASGLACVEGHCTIGCRSNKECKQDQSCIENKCLNPCQSANSCGPNALCS
IDQHHSQCSCPEGFEGNPTPEQGCVRVPAPCLASNQCPSGHMCIGNQCNLPCTKTASCAV
GERCYQQVCRKVCYTSNNCLAGEICNSDRTCQPGCDSDADCPPTELCLTGKCKCATGFIG
TPFGCSDIDECTEQPCHASARCENLPGTYRCVCPEGTVGDGYSQPGCSQPRQCHKPDDCA
NSLACIHGKCTDPCLHTVCGINANCQSEGHEALCSCPAGFLGDPNDTGVGCFKVECIDHV
DCAEDRACDAETNRCIKPCDLTSCGKGNCQVKDHKATCACYEGYQLVNGICEDMNECLSQ
PCHSTAFCNNLPGSYSCQCPEGLIGDPLQAGCRDPNECLSDADCPASASCQNSRCRSPCE
RQNACGLNANCQAQGHQAICTCPLNSRGDPAIECVHIECADNDDCSGEKACLDSKCIDPC
SLPNACGALARCSVQNHIGVCSCEAGSTGDAKLGCVQLQYCQQDGQCAQGSICSHGICSP
LCSTNRDCISEQLCLQGVCQGTCKSNSSCPQFQFCLNNICTKELECRSDSECGEDETCLS
DAYGRAKCESVCLGRAACGRNAECVARSHAPDCLCKEGFFGDAKSGCRKIECSSDDDCSN
DKSCDNHMCKIACLIGQPCGENALCTTEHHQQVCHCQPGFSGDPRVRCDVIDFCRDAPCG
PGARCRNARGSYKCTCPPGLVGDPYNEGCRSSVECETNEDCPPHAACTKTNGVAKCRDVC
AQLQCGPNAECVPKGHVAQCACRSGYDGQPADRVAGCKPLPSPCQVTGDCPTNTYCSDSV
CKPACVLDTECGAFEVCQGGQCFNPCLQPQACGQNAECVMQNHLKQCHCPEGFTGDSAKE
CVRVPVACDGECAPGYTCRDSMCLPVCHNDLECASNEKCLKGSCMLTCRVDNDCFLGHVC
LHNKCVYGCHVDDDCSASESCRNDKCVNPCLESPCGPNAACSVSNHRASCSCLESMVPNP
TPQVGCVRSPPLECRENRDCGNGLACFESVCRPLCADDAGCLTNERCQQGVCKPLCRHDN
ECGHGELCLGLNCVPGCRSDQGCPQDLSCVGQQCVDPCADPTACGTNALCQTIDHRKQCL
CPEGLDGNANVACKVPRIACGRNEDCQSNQLCYAGSCQGKCRNDQNCLADERCMRGTCRT
VCNTDEACAQGQICENRMCQTGCRTDLSCATDEACVNKKCQNPCRTPGQCGQCADCLVVN
HGVQCQCPAAFMGDGLTGCQLPPERCHPGCECDENGAYCAAKCSRTEDCACGQQCARGKC
RNKCGPKRQCTVGQLCERGACIAGCKSNGDCAADQSCVNGKCSDPCANEKACGRNALCTV
SEHRMLCYCPDGYEGEPSKECVQFECRVDTDCDSNKRCDQGKCRNPCLEYGACGTNAQCR
VVGRKAQCSCPPDFFGNPTSECRPLEGGCSSKPCGENSKCTEVPGGYECACMDGCIGDAH
QGCLCGGPLVNACRDHPCGLNAACHVLENNQAECYCPEDFPNGDAYVQCYLTTPKQDCRT
LGCEVGGCVRQGYEYVCQQDTEQCYSDTDCPSEKSCLQGHCSDPCTMRGVCGLNALCKTV
LHRPRCSCPSCHIGRPEIECKSDPKCLPEDTDPKTKEQVPCSTDSECPETLQCGQYGQCT
DPCNNPLFICESNKKCETRRHQPVCICKSGFIVNEFGELTCAPDKRECYRDDDCASNMAC
ADGKCRNPCIVPLGRAAICAENKSCEVQNHKPVCICMRDCQPSISICLRDAGCPASQACR
KLKCVDPCEFATCAPNSPCIVEDHKPICKFCPAGFIADAKNGCQKGCRPECTSNSDCPLD
KYCLNLRCRDPCPGACGIRAICHVQNHGPLCVCPPYLTGNPLLACQPIAPSDPCQPSPCG
ANALCNNGQCSCLPEYHGDPYTGCRPECVLNSDCPRNRACVNQKCVDPCPGHCGLNALCD
AVNHIAMCHCPERMTGNAFVSCQPIREDPPTITPNPCQPSPCGTNAQCLERNGNAICSCL
AGYFGQPPNCRLECYSSSDCSQVHTCINNKCVDPCPGKCGLNAVCQAIQHRAHCECIPRY
TGNAFVRCNPIPVPILPEPVRDPCQPSPCGPNSQCTNVNSQAECRCLQEFQGTPPNCRPE
CVSHDECANTLACMNQKCRDPCPGSCGQGAQCTVSLHIPNCQCPVGMTGDPFRICLPKPR
GKISQVTTPKSRILPTCQNQSVPILNPFKQEYHPKVINSLTQYKNISYNI
Download sequence
Identical sequences FBpp0142914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]