SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0142936 from Drosophila erecta 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0142936
Domain Number 1 Region: 4108-4324
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.42e-29
Family Laminin G-like module 0.0047
Further Details:      
 
Domain Number 2 Region: 1915-2018
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-29
Family Cadherin 0.00071
Further Details:      
 
Domain Number 3 Region: 1377-1480
Classification Level Classification E-value
Superfamily Cadherin-like 1.43e-28
Family Cadherin 0.00095
Further Details:      
 
Domain Number 4 Region: 2377-2490
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-28
Family Cadherin 0.00089
Further Details:      
 
Domain Number 5 Region: 1476-1611
Classification Level Classification E-value
Superfamily Cadherin-like 1.7e-27
Family Cadherin 0.0011
Further Details:      
 
Domain Number 6 Region: 2798-2914
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-27
Family Cadherin 0.0014
Further Details:      
 
Domain Number 7 Region: 487-591
Classification Level Classification E-value
Superfamily Cadherin-like 7.28e-27
Family Cadherin 0.0028
Further Details:      
 
Domain Number 8 Region: 587-715
Classification Level Classification E-value
Superfamily Cadherin-like 8.99e-27
Family Cadherin 0.0016
Further Details:      
 
Domain Number 9 Region: 1270-1375
Classification Level Classification E-value
Superfamily Cadherin-like 2.09e-26
Family Cadherin 0.00097
Further Details:      
 
Domain Number 10 Region: 2271-2383
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-26
Family Cadherin 0.00057
Further Details:      
 
Domain Number 11 Region: 3225-3326
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-26
Family Cadherin 0.001
Further Details:      
 
Domain Number 12 Region: 3539-3650
Classification Level Classification E-value
Superfamily Cadherin-like 3.57e-26
Family Cadherin 0.0013
Further Details:      
 
Domain Number 13 Region: 2483-2588
Classification Level Classification E-value
Superfamily Cadherin-like 4.06e-26
Family Cadherin 0.00084
Further Details:      
 
Domain Number 14 Region: 1041-1144
Classification Level Classification E-value
Superfamily Cadherin-like 3.57e-25
Family Cadherin 0.0015
Further Details:      
 
Domain Number 15 Region: 2015-2107
Classification Level Classification E-value
Superfamily Cadherin-like 7e-24
Family Cadherin 0.0011
Further Details:      
 
Domain Number 16 Region: 2906-3012
Classification Level Classification E-value
Superfamily Cadherin-like 3.8e-23
Family Cadherin 0.0015
Further Details:      
 
Domain Number 17 Region: 3326-3429
Classification Level Classification E-value
Superfamily Cadherin-like 4e-23
Family Cadherin 0.0014
Further Details:      
 
Domain Number 18 Region: 3000-3133
Classification Level Classification E-value
Superfamily Cadherin-like 4e-23
Family Cadherin 0.0017
Further Details:      
 
Domain Number 19 Region: 258-385
Classification Level Classification E-value
Superfamily Cadherin-like 1.28e-22
Family Cadherin 0.0016
Further Details:      
 
Domain Number 20 Region: 3431-3537
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-22
Family Cadherin 0.0011
Further Details:      
 
Domain Number 21 Region: 3643-3748
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-22
Family Cadherin 0.0017
Further Details:      
 
Domain Number 22 Region: 4349-4388,4426-4568
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.26e-21
Family Laminin G-like module 0.005
Further Details:      
 
Domain Number 23 Region: 150-270
Classification Level Classification E-value
Superfamily Cadherin-like 7.2e-21
Family Cadherin 0.0065
Further Details:      
 
Domain Number 24 Region: 1146-1270
Classification Level Classification E-value
Superfamily Cadherin-like 7.71e-21
Family Cadherin 0.0021
Further Details:      
 
Domain Number 25 Region: 936-1041
Classification Level Classification E-value
Superfamily Cadherin-like 2e-20
Family Cadherin 0.0046
Further Details:      
 
Domain Number 26 Region: 2159-2269
Classification Level Classification E-value
Superfamily Cadherin-like 9.42e-20
Family Cadherin 0.0017
Further Details:      
 
Domain Number 27 Region: 1816-1913
Classification Level Classification E-value
Superfamily Cadherin-like 8.14e-19
Family Cadherin 0.0037
Further Details:      
 
Domain Number 28 Region: 376-486
Classification Level Classification E-value
Superfamily Cadherin-like 1.08e-18
Family Cadherin 0.0028
Further Details:      
 
Domain Number 29 Region: 3111-3222
Classification Level Classification E-value
Superfamily Cadherin-like 4.85e-18
Family Cadherin 0.0023
Further Details:      
 
Domain Number 30 Region: 2583-2693
Classification Level Classification E-value
Superfamily Cadherin-like 6.28e-18
Family Cadherin 0.0012
Further Details:      
 
Domain Number 31 Region: 2709-2801
Classification Level Classification E-value
Superfamily Cadherin-like 3.57e-16
Family Cadherin 0.0032
Further Details:      
 
Domain Number 32 Region: 849-941
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000214
Family Cadherin 0.0043
Further Details:      
 
Domain Number 33 Region: 1593-1697
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000183
Family Cadherin 0.002
Further Details:      
 
Domain Number 34 Region: 1710-1814
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000271
Family Cadherin 0.0021
Further Details:      
 
Domain Number 35 Region: 701-810
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000357
Family Cadherin 0.0028
Further Details:      
 
Domain Number 36 Region: 92-156
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000628
Family Cadherin 0.0075
Further Details:      
 
Domain Number 37 Region: 4053-4090
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000147
Family EGF-type module 0.0092
Further Details:      
 
Weak hits

Sequence:  FBpp0142936
Domain Number - Region: 4013-4051
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000105
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 3992-4016
Classification Level Classification E-value
Superfamily EGF/Laminin 0.028
Family EGF-type module 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0142936   Gene: FBgn0116522   Transcript: FBtr0144444
Sequence length 5150
Comment type=protein; loc=scaffold_4929:complement(4272453..4275132,4275197..4278753,4278812..4281574,4281841..4282127,4282197..4282398,4282466..4282699,4282764..4283072,4285917..4291337); ID=FBpp0142936; name=Dere\GG24390-PA; parent=FBgn0116522,FBtr0144444; dbxref=FlyBase:FBpp0142936,FlyBase_Annotation_IDs:GG24390-PA,GB_protein:EDV57707,REFSEQ:XP_001968648,FlyMine:FBpp0142936; MD5=968203ddf6be75a5907738eccc17792c; length=5150; release=r1.3; species=Dere;
Sequence
MERLLLLFYLLLAGRESLCQTGDTKLELLAPRGRSYATTYEQYAAFPRRRSSSSSPSGEM
QSRAVDTSADFEVLEGQPRGTSVGFIPTKPKFSYRFNEPPREFTLDPVTGEVKTNVVLDR
EGMRDHYDLVVLSSQPTYPIEVRIKVLDVNDNSPEFPEPSIAISFSESATSGTRLLLDAA
TDADVGENGVTDQYEIVAGNVDNKFRLATTANPSGDTSYLHLETTGNLDRESRGSYQLNI
SARDGGSPPRFGYLQVNVTILDVNDNPPIFDHSDYNVSLNETALPGTPVVTVMASDNDLG
DNSKITYYLAETEHQFTVNPETGVISNTERVNCPQQTNVKNSASQKSCVFTVFARDHGSP
RQDGRAYVTVNLLDTNDHDPIISFRFFPDGGKVATVDENAVNGTVVAAVAVKDSDSGLNG
RTSVRIVSGNELGHFRLEEAADLHIVRVNGVLDREEIGKYNLTVVAMDQGTPARTTTAHL
IIDVNDVNDHEPVFEKSEYSAVLSELAPTGSFVASITATDEDTGVNAQVHYDILSGNELK
WFAMDPLTGLIVTTGALDREIRDTVELSISARDGGPNPKFAYTQLKVIVLDENDEAPQFS
QREQNVTLGEDAPPQTIVALMTATDHDQGTNGSVTFALAPSVERLYPLQFALDALTGQLT
TRRPLDREKMSRYEIPVIARDQGAPTPQSATATVWLNVADVNDNDPQFYPRHYIYSLTDD
DAIKLREEVEKERILLHVTASDKDDGDNALIEYRLESGGEGLFQLDARSGALSLRGDAPA
SMHWKPHYKLLVSARDAGQRRSQQDAIVEIVLKSKAELLECGQAQAGGYEFQMVEDHEQQ
RNSQPNREVGIVQVKSTNGKANSHIEYDIIQGDRAQSFRIDPRNGRITTARPLDREEQAN
YRLTILASSSSSSSAAATSVSYGQCIVNIAIIDLNDNAPVFALDRESEPTISLPENAAVG
QEIYLSRVRDRDAGMNSRISYSLTNNPNQQFRIGPVTGVLYLQRPIRAEPGSQIHVELMA
TDAGSPPLSSKLSLSVLIADVNDHTPVFDHTSYETSLPETTKVNTRFFALAATDIDLGDN
GRISYEIIEGNTERMFGVFPDGFLFVRAPLDREERDYYALTVSCQDAGQPSRSSVVPVVI
HVIDENDNAPQFTNSTFTFSIPENAPADTFVGKLTAVDRDIGRNAELSFTLSSQTQDFTI
DTRNGFIKTLRPFDREALVKVSRSAEAGGEDASLRGSVAGNYMLLEATVSDNGIPRLQDK
VKVKVIVTDVNDNAPEFLRAPYHVTISEGASEGTHITHVFTQDADEGLNGDVYYTLAKGN
EAGQFSLDGATGQLSLARRLDRESQEIHHLVVVAKDAALKHPLSSNASVTIVVLDENDNA
PEFTQSSSEVSVLETSPTGTELMRFRASDADQGVNSQVVFSISAGNRRDTFHIDSITGSL
YLHKPLDYEDITSYTLNITASDCGTPSLSTTVLYNVLVVDDNDNPPIFPSTAIVRQIKEG
IPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGRHFGINTETGVIHTLREIDRESI
DTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMNAAILPPKFSTSKGSST
AVMQVHAKDADSSSNGLVTYEIVSGPQELFKLQRNTGVVTFTPGPQFKQEVRYQLTLKAT
DEAVQSERRSSEVYITIITPGSGGSESSVPQFEQRSKHSGSVYENEPIGTSILTVTAHLA
SAEIEYFVTNVTAVGSRGQVDRLFDIDAKLGILSTAAELDREAGPEEYEVEVYAIALGGQ
PRTSRTKVRVTVLDKNDSPPQFLDTPFVYNVSEDLQIGHIISTLRAHDPDTIGSVTFLLM
DGHDGKFLLEPSTGKLVLNDTLDRETKSKYELRIRVSDGVQYTEAYATIQVSDTNDNPPL
FEDTVYSFDIPENAQRGYQVGQIVARDADLGQNAQLSYGVVSDWANDVFSLNPQTGMLTL
TARLDYEEVQHYILIVQAQDNGQPSLSTTITVYCNVLDLNDNAPIFDPMSYSSEVFENVP
LATEVVTVSAKDIDSGNNGLIEYSITAGDVDSEFRIDSNGTIRTRRHLDREHRSAYTLTV
TARDCADEFASFSELEETQLKLKYRSPRKYQQTRQEFLAHQKQQRLSSTVKVTILIKDVN
DEVPVFVSANETAIMENVAINTVVIAVKAVDNDEGRNGYIDYLMKEARDEDIGQSDPLPF
SLNPTDGQLRVVDALDRELRSSYLLNITARDRGEPPQATETQLLIRILDENDNSPVFDPK
QYSASVAENASIGAMVLQVSATDVDEGANGRIRYSIVLGDQNHDFSISEDTGVVRVAKNL
NYERLARYSLTVRAEDCALENPAGDTAELTINILDINDNRPTFLDSPYLARVMENTVPPN
GGYVLTVNAYDADTPPLNSQVRYFLKEGDSDLFRINASSGDIALLKPLDREQQREYTLTL
VAMDTGSPPLTGTGIVRVEVQDINDNDPVFELQSYHATVRENLPAGTHVLTPKATDKDEG
LNAKLRFNLLGEHMHRFHIDSETGEISTATTLDREETSVYHLTLMAQDSSITEPRASSVN
LTISVSDVNDNIPKFDSTTYNVAVPERISQGEFVFGARALDLDDGENAVVHYTLSGRDQH
YFDINTKTGVVSTKLELRTKTKSPDDLTYTIVISAMDQGEQPLTSKAELTVILRPPELFP
TFAYMANSHFTMSEDARPGKMITKVSATSPKKGLVGKVRYAIAGGVMGDALRVDPNSGVL
SVGQDGLDYELTHLYEIWVEAADGDTPSLRSVTLITLNVTDANDNAPVMEQLIYNAEVLE
EESPPQLIAVVRASDRDSGDNGNVIYRLQNDFDGTFEITESGEIYTRMRLDREEIGDYAF
VVEAVDQGVPHLTGTASVLLHLLDKNDNPPKFTRLFSLNVTENTEIGSFVIRVTSSDLDL
GANANASYSFSENPGEKFRIDPQSGNITVAGHLDREQQDEYILKVVASDGAWRAETPITI
TIQDQNDNAPEFEHSFYSFSFPELQQSIALVGQILATDRDKQGPNSVISYSLQQPSPMFS
IDPATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGKPPLYSECLVNINIVDAHNNP
PKFEQEEYLAPLPQDAVRGQRIVRVHANDKQDLGTNEMDYSLVTSNLSSIFTIGRHDGWI
TLVRPIQVPPNTRYELVVRATDRGVPPQSDETRVIIVVTGQNLKAPGFSVNSYQVIVPEN
EPVGSIILTVGATDEDTGPNGMLRYSISGGNERQDFSVDERTGGIVIQQQLDYDLIQEYH
LNITVQDLGYHPLSSVAMLTIILTDVNDNPPVFDQKEYHGYIPENKPVGTFVFQAHATDK
DSPKNAIIHYAFLPSGPDRHFFMMHQSNGTISSAVSFDYEERRLYTLQIRAKNPDSSMES
YANLYVHVLGVNEFYPQFLQAVFHFDVSETSAVGTRVGAVQATDKDSGEDGRVYYLLVGS
SNDKGFRIDTNTGLIYVARHLDRETQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGND
PPEFIKHYYTSTISEAAPIGTKVTTVKAVDKDVRSQNNQFSYSIINGNLKQSFKIDVQTG
EISTASRLDREEIATYNLVIGAIDTGLPPQTGSATVHIELEDVNDNGPTFTTEGLNGYVS
ENEPPGTSIMTLMASDPDLPRNGGPFTYQLVGGKHKSWLSVDRSSGVVRSTTSFDREITP
VLEAIIEVEDSGKPKQKAQHLVTITVLDQNDNPSTTRSLHIAVSLFNGDLPPNVKLADVR
PNDIDIVGDYRCRLQKNPAQSQLQLAIPRACDLLTTSHTTPIASVFSYTGNDGKHGDVSS
KVSVAFQSFNNETLANSVSIMVRNMTANHFLANHYRPILEMIKSRMSNEDEVILYSLLEG
GSGNSTNLQLLMAARSAKSSYQQPKHLIERLREKRSAFSELLQKEVIVGYEPCSEPDVCE
NGGVCSATIRLLDAHSFVIQDSPALVLSGPRVVHDYSCQCTSGFSGEQCSRRQDPCLPNP
CHSQVQCRRLGSDFQCMCPANRDGKHCEKERSDVCYSKPCRNGGSCQRSPDGSSYFCLCR
PGFRGNQCESVSDSCRPNPCLHGGLCVSLKPGYKCNCTPGRYGRHCERFSYGFQPLSYMT
FPALDVTTNDISIVFATTKPNSLLLYNYGMQSGGRSDFLAIELVQGRAYFSSGGARTAIS
TVIAGRNLADGGWHKVTATRNGRVMSLSVAKCADSGDICTECLPGDSSCYADEVGPVGTL
NFNKQPLMIGGLASADPILERPGQVHSDDLVGCLHSVHIAGRALNLSSPLQQRGILAGCN
RQACQPALAAERCGGFAGQCIDRWSSSLCQCGGHLQSPDCSDSLEPITLGEGAFVEFRIS
EIYRRMQLLDNLYSSKSAWLDSSQMRERRAVSNFSTASQIYEAPKMLSVLFRTHKDQGQI
LYAATNQMFTSLSLREGRLVYYSKQHLTINMTVQETALLNDGRWHNVSLFSESRSLRLIV
DGRQVGDELDIAGVHDFLDPYLTTLNVGGEAFAGCLANVTVNNELQPLNGSGSIFPEVRY
HGKIESGCHGDIGQDAAQVADPLSIGFTLVIVFFVILVVAILGSYVIYRFRGKQEKIGSL
SCGVPGFKIKHPGGPVTQSQVDHVLVRNLHASEAPSPPVGAGDHMRPPVGSHHLVGPELL
TKKFKEPTAELPQPQQQQQRPQRPDIIERESPLIREDHHLPIPPLHPLPLEHASSVDMGS
EYPEHYDLENASSIAPSDIDIVYHYKGYREAAGLRKYKASVPPVSAYTHHKHQNSGSQQQ
QQQHRHTAPFVTRNQGGQPPPPPTSASRTHQSTPLARLSPSSELSSQQPRILTLHDISGK
PLQSALLATTSSSGGVGKDVHSNSERSLNSPVMSQLSGQSSSASRQKPGVPQQQAQQTSM
GLTAEEIERLNGRPRTCSLISTLDAVSSSSEAPRVSSSALHMSLGGDVDAHSSTSTDESG
NDSFTCSEIEYDNNSLSGDGKYSTSKSLLDGRSPVSRALSGGETSRNPPTTVVKTPPIPP
HAYDGFESSFRGSLSTLVASDDDIANHLSGIYRKANGAASPSATTLGWEYLLNWGPSYEN
LMGVFKDIAELPDTNGPSQQQQQQQQQHTQNVSTLRMPSSNGPAAPEEYV
Download sequence
Identical sequences FBpp0142936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]